CAZyme Information: MGYG000001780_00304

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001780_00304
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
514	MGYG000001780_2|CGC3	57793.85	6.0904

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001780	6261722	MAG	Denmark	Europe

• Gene Location: Start: 87954; End: 89498 Strand: +

Full Sequence      

MKNFKLLLLGLCVVMCACSAQTQTSQTNEYGTEWHWENGTIVVKTPERPAGQKSVLGLTT
PKMESVRVGFVGLGMRGPGAVERFTYIPGTQVVALCDYEQSRAEKCQKYLKKASMPKAAI
YSGEKGYEELCKRDDIDLVYIAADWLHHFSVAKCALENGKHVAIEVPSAMNLQECWDLIN
LSETTRKHCFILENCCYDWYEMNTLNMAQNGVFGEIIRAQGAYIHNLAPFWDHYWKAGEN
DKLGWRLDYNMRHRGDVYATHGLGPVAQVLDIHRGDRMKTLVAMDTKSVIGKALVEERAD
SVCNNFRNGDHTTTMIRTENGKVIEIQHNVMTPQPYNRLYQLTGTKGFANKYPVRGYALD
AEQLSASGVQPKIDDLNSHGFLPKAEMDALVEKYQHPILKKYGELAKEVGGHGGMDFIMD
CRLVYCLQNGLPLDMDVYDLAEWCCLAELGTLSMDNNCAAVAFPDFTRGEWNVVKGYKHA
YASPEAEKAAEEKAEAFTAELKQRGAKEWEEAEN

Enzyme Prediction     

No EC number prediction in MGYG000001780_00304.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	62	472	1e-156	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	8.04e-22	63	392	1	303	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.31e-11	66	191	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	7.92e-06	64	187	3	116	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59362.1	0.0	1	514	1	513
QUT89581.1	0.0	1	514	1	513
QUU00485.1	0.0	1	509	1	509
BBK85756.1	0.0	1	509	1	509
QUT33817.1	0.0	1	509	1	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	3.21e-84	48	471	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	1.16e-66	64	475	19	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E9M_A	1.45e-07	102	220	39	152	CrystalStructure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_B Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_C Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_D Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis]
3E82_A	1.61e-06	56	216	3	148	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]
3EVN_A	2.51e-06	63	217	3	149	CRYSTALSTRUCTURE OF putative oxidoreductase from Streptococcus agalactiae 2603V/r [Streptococcus agalactiae serogroup V]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6KWM1	0.0	1	509	1	510	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
A6L1Z2	0.0	1	509	1	511	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KYY1	4.12e-242	3	498	2	494	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
Q5LGZ0	9.43e-206	2	482	3	463	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1
P0C863	9.43e-206	2	482	3	463	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000298	0.344010	0.655252	0.000141	0.000165	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001780_00304.