CAZyme Information: MGYG000001780_00375

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001780_00375
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
572	MGYG000001780_2|CGC4	64392.08	6.0399

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001780	6261722	MAG	Denmark	Europe

• Gene Location: Start: 172395; End: 174113 Strand: +

Full Sequence      

MRFMILSVLAVLLSCSSKAGELRMASSDGKVIVAYVTSWSSVMPDPQYMTHINYAFGHVS
ETFNGVGIDNENRLREIVALKAQKPGLKIMLSIGGWGSGRFSEMAANDEFRLAFAKDCKR
VVKEYGLDGIDIDWEYPTSAAANISASPDDTKNFTLLMRDIRKEIGKKKLLTLATVASGE
YIDFKAILPYIDFVNIMSYDMGNAPKHHAALYSSENTGWMTADAAVEAHLKAGIPASKLT
MGVPFYGRGGDQYPNFQDYRKVGGTSEFEERWDDTAKVPYLANKDGVLVFGYENPRSLAI
KCQYILDKGLLGGMYWDYAGDNPQGDLRRTMYESLLVNKKGQAAPYQVLVLTERGGQHGG
FTDAGLQWLAQESGAMNFEITEINNAKPITEEYLNRFHLIIQLDYPPYTWSEAAQAAFTK
YIDEGRGGWIGFHHATLLGEFDGYPMWQWFSDFMGGVRFKNYIAPLADGVVITEDSEHPV
MKGVQGTFIIPDDEWYTYDKSPRRNVHVLAHVDEYSYTPASDVKMGDHPVVWVNESKKAR
NVYFQIGHSKKLYETEDFTKMFRNAIQWTLKK

Enzyme Prediction     

No EC number prediction in MGYG000001780_00375.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	30	328	1.9e-73	0.9594594594594594

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	2.05e-104	32	321	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	5.22e-81	31	321	1	334	Glyco_18 domain.
pfam00704	Glyco_hydro_18	1.27e-78	31	321	1	307	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	8.01e-70	32	320	1	345	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
pfam06283	ThuA	2.48e-62	348	569	2	213	Trehalose utilisation. This family consists of several bacterial ThuA like proteins. ThuA appears to be involved in utilisation of trehalose. The thuA and thuB genes form part of the trehalose/sucrose transport operon thuEFGKAB, which is located on the pSymB megaplasmid. The thuA and thuB genes are induced in vitro by trehalose but not by sucrose and the extent of its induction depends on the concentration of trehalose available in the medium.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO71383.1	0.0	1	572	4	576
QQA31016.1	0.0	2	572	5	574
QUT64703.1	0.0	2	572	5	574
BBK89352.1	0.0	2	572	5	574
ALJ58703.1	0.0	2	572	5	573

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6INX_A	1.07e-53	49	335	27	342	Structuralinsights into a novel glycoside hydrolase family 18 N-acetylglucosaminidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
6TSB_AAA	5.11e-53	32	331	37	346	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	8.21e-53	32	331	56	365	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
3QOK_A	4.95e-52	45	335	50	416	ChainA, Putative chitinase II [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
6HM1_A	1.16e-51	45	338	27	396	Structuraland thermodynamic signatures of ligand binding to an enigmatic chitinase-D from Serratia proteamaculans [Serratia proteamaculans 568]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	2.05e-43	26	321	40	438	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
P11797	4.39e-35	35	327	21	414	Chitinase B OS=Serratia marcescens OX=615 GN=chiB PE=1 SV=1
Q13231	2.51e-32	32	320	24	367	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
P32470	6.31e-32	50	335	85	398	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
P36362	6.72e-32	32	325	25	379	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000370	0.460455	0.538648	0.000177	0.000180	0.000160

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001780_00375.