CAZyme Information: MGYG000001780_00708

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001780_00708
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408	MGYG000001780_4|CGC1	46821.53	7.1362

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001780	6261722	MAG	Denmark	Europe

• Gene Location: Start: 24215; End: 25441 Strand: -

Full Sequence      

MSEIFSIFNPDWWVDENNNALQIADAILFLLLSIPVLYLFVCALFSLGKYKNPYPPAKVH
HRFLVLFTVLRNGKEVIHSINSFLDTQLYPRDKYDIAVAATQLPEEDLVTLLQMPVNIVV
PDKEQCTKVYAIQQVMERYSPAEYDMVIIFNSDNRIVPNALNLFNNAYYSGCDAIQAHRM
TENLTTSIAVLNATSEEINNNIFRKAHTRMGFSSALIGSAMAFDFPMFHEIAPKLKGSDL
SKAMETALLQQNIYTEYMEEVVCYSKKEESANGYEAQRIGWLRSQYSSTILALKKLPITL
LKGEWDYALKLFQWLMPSRFLLIALITLCAIGITLLDWTLSFKWYTLLGVIIITFIMALP
DGEVNKRFKHSIWALPILVFASLFSHITRFFQKKKTPKDKKTEESENK

Enzyme Prediction     

No EC number prediction in MGYG000001780_00708.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	62	282	2.2e-26	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13641	Glyco_tranf_2_3	1.02e-31	60	284	1	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06438	EpsO_like	7.74e-11	84	223	19	162	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
COG1215	BcsA	4.98e-06	20	360	12	359	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT91826.1	6.12e-263	1	403	1	407
ALJ62437.1	6.07e-257	1	401	1	401
QDO70188.1	6.69e-240	1	395	1	395
AVM52045.1	3.06e-233	1	394	1	394
QUT47270.1	3.49e-232	3	390	4	391

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000093	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
26	48
210	232
311	333
340	359
372	391