CAZyme Information: MGYG000001780_01226

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001780_01226
• CAZy Family: GH106
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1000	MGYG000001780_7|CGC1	113389.61	6.9886

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001780	6261722	MAG	Denmark	Europe

• Gene Location: Start: 29944; End: 32946 Strand: -

Full Sequence      

MNLLKYTLLATGLFLSGINHWVSAEELKEMKRMFVSPPESARPGVYWYFMDGNLSKEGMT
KDLESMKQAGIGSVVFLEVNDGIPRGNVDFLSPEWKDCFKHAVKECERLGISMILGIGPG
WTGSGGPWVKGEESMRHLVSSVTRVTGGSKQTIALKKPLPKHPFFGEGKFTLELKKRWLD
YYEDVAVLAFPATNSKVSIKDIEEKALYYRGPYSSVPGVKQFIPREEQDKLLEPGDAVSV
DQIIDLTSLLKDESVIWDVPSGEWMIMRFGIRNNGAVTRPAPLPGVGFECDKTDTTALMA
HLRTFTGALFDFIGERDTTLTGGIKILHMDSWEMGTQNWSPRLREEFKKRRGYDSQPYFP
VYAGVVVGDKNISERFLWDLRQTMQELMLENHSLFVKAYAHQHGMQLSIEPYDMNPMQDL
ELGASADIPMCEFWSPGGYNTSFSAIEGSSLANIKGQRVVPSEAFTASGDGWRQHPASMK
NQTDWAFAAGINRLTYHTFQHQALPDSLRPGMTMGKHGVHWDRNQTWWPYVDAYHTYVTR
CQYLLQKGQTVADILYLAPEEAPFVFRAPKSALTGDFMVDKREYNFDACPPSLLYSAFVE
DGKIKFPSGMEYRLLVLPTFKTMTLDLLKKIEALVKEGAVVIGLPPSQTPGLTDYPNCDR
KLQQTAENLWGGNKMPEGLVFHTLGKGRIAWGTDIQNHLDNLYPDFDLTSKVLREMQVPI
DFMSDQGMVRYIHKQMDDVDYFFVSNRMDKDMSVYAHFRSFGKQPYLWDPVTGKISLIPV
SKDNGKQTSMELSFASYQSYFVFFSGKRLSPSSASTNIKGERVLMSLQGSWSVSFDPKWG
GPKQIEFPTLQDWSKQLDSGIKYYSGTAVYTKCFNYEDVLSSSLFLDLGLVKNIARIWLN
GKDLGTIWTSPWRVDITHALKSGKNELKIEVTNLWVNRLIGDEQKENDGIVNRQWPRWLL
KGEKRPSNRYTFTTFSHYKKDSPLLESGLLGPVHIIQVLE

Enzyme Prediction     

No EC number prediction in MGYG000001780_01226.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH106	237	996	4.7e-205	0.8871359223300971

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17132	Glyco_hydro_106	0.0	36	781	2	870	alpha-L-rhamnosidase.
cd03143	A4_beta-galactosidase_middle_domain	0.001	612	691	54	130	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEC76244.1	0.0	14	995	12	996
BAU55722.1	0.0	5	997	7	1004
QEM10488.1	0.0	21	997	17	1000
AWO01984.1	0.0	30	995	20	986
ASU36259.1	0.0	30	995	18	990

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q2F_A	1.24e-134	30	997	42	1140	Structureof Rhamnosidase from Novosphingobium sp. PP1Y [Novosphingobium sp. PP1Y]
5MQM_A	2.96e-106	30	994	31	1097	Glycosidehydrolase BT_0986 [Bacteroides thetaiotaomicron],5MQN_A Glycoside hydrolase BT_0986 [Bacteroides thetaiotaomicron]
5MWK_A	7.81e-106	30	994	31	1097	Glycosidehydrolase BT_0986 [Bacteroides thetaiotaomicron]
6D89_A	1.17e-09	822	966	34	191	Bacteroidesuniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_B Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_C Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_D Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis]
6D1N_A	4.65e-09	852	966	94	199	Apostructure of Bacteroides uniformis Beta-glucuronidase 1 [Bacteroides uniformis],6D1N_B Apo structure of Bacteroides uniformis Beta-glucuronidase 1 [Bacteroides uniformis],6D41_A Bacteriodes uniformis beta-glucuronidase 1 bound to D-glucaro-1,5-lactone [Bacteroides uniformis],6D41_B Bacteriodes uniformis beta-glucuronidase 1 bound to D-glucaro-1,5-lactone [Bacteroides uniformis],6D6W_A Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_B Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_C Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_D Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D7F_A Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_B Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_C Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_D Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_E Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_F Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNA8	5.11e-165	4	1000	5	1160	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22040 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000385	0.998871	0.000246	0.000159	0.000155	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001780_01226.