CAZyme Information: MGYG000001780_01785

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001780_01785
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000001780_10|CGC4	42312.3	6.9591

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001780	6261722	MAG	Denmark	Europe

• Gene Location: Start: 126193; End: 127308 Strand: +

Full Sequence      

MKNKNLLYVLLIGCALNSCGSNPATGDETSLKEAVGNKFHIGVAMNTAQSSGRDTTAVQL
IKKHFNSVVAENCMKSAVIHPEENRYNFSQADEFVKFGEENGMFVIGHCLMWHSQLPRWF
CTDSEGKNVTPEVLKQRMKDHIYTVVGRYKGRVKGWDVVNEAIIEDGSYRKTKFYEILGE
EFIPLAFQYAHEADPDAELYYNDYGMNVEGRRNTVVKMVKDMKEKGLRVDAIGMQGHMGM
DYPDMKEFEESILAFASTGAKVMITEWDMSALPTAKRSANISDTVAYRKMLNPYTEALPD
SVSEKWNTRMADFFNLFMKHSDIITRVTAWGVTDGDSWKNGFPIRGRKDYPLLFDRNYQP
KPFVKELIEKK

Enzyme Prediction     

No EC number prediction in MGYG000001780_01785.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	30	369	2.3e-106	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	2.08e-123	31	362	1	303	Glycosyl hydrolase family 10.
smart00633	Glyco_10	1.57e-111	74	362	1	258	Glycosyl hydrolase family 10.
COG3693	XynA	2.70e-98	6	371	6	341	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT92911.1	3.55e-257	1	371	1	371
ALJ61519.1	1.02e-256	1	371	1	371
QRQ48270.1	4.48e-216	1	369	1	369
QUT46123.1	4.48e-216	1	369	1	369
BAD80892.1	7.67e-204	1	370	1	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PMU_A	2.44e-105	29	368	1	350	Crystalstructure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_B Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_C Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_D Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_E Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_F Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306]
4PMV_A	2.52e-105	29	368	2	351	Crystalstructure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P43212) [Xanthomonas citri pv. citri str. 306],4PMV_B Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P43212) [Xanthomonas citri pv. citri str. 306]
1UQY_A	2.93e-101	27	371	23	369	XylanaseXyn10B mutant (E262S) from Cellvibrio mixtus in complex with xylopentaose [Cellvibrio mixtus],1UQZ_A Xylanase Xyn10B mutant (E262S) from Cellvibrio mixtus in complex with 4-O-methyl glucuronic acid [Cellvibrio mixtus],1UR1_A Xylanase Xyn10B mutant (E262S) from Cellvibrio mixtus in complex with arabinofuranose alpha-1,3 linked to xylobiose [Cellvibrio mixtus],1UR2_A Xylanase Xyn10B mutant (E262S) from Cellvibrio mixtus in complex with arabinofuranose alpha 1,3 linked to xylotriose [Cellvibrio mixtus]
2CNC_A	2.14e-100	1	371	3	378	Family10 xylanase [Cellvibrio mixtus]
6FHE_A	2.84e-97	39	362	21	333	Highlyactive enzymes by automated modular backbone assembly and sequence design [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49942	7.77e-180	1	370	1	371	Endo-1,4-beta-xylanase A OS=Bacteroides ovatus OX=28116 GN=xylI PE=2 SV=1
P48789	1.57e-129	27	369	22	366	Endo-1,4-beta-xylanase A OS=Prevotella ruminicola OX=839 GN=xynA PE=3 SV=1
Q12603	4.21e-80	6	369	10	351	Beta-1,4-xylanase OS=Dictyoglomus thermophilum OX=14 GN=xynA PE=3 SV=1
O69231	1.82e-79	30	361	7	322	Endo-1,4-beta-xylanase B OS=Paenibacillus barcinonensis OX=198119 GN=xynB PE=1 SV=1
P45703	1.73e-76	19	362	2	322	Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus OX=1422 GN=xynA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000039	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001780_01785.