CAZyme Information: MGYG000001780_01906

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001780_01906
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
844	MGYG000001780_11|CGC3	96469.02	6.377

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001780	6261722	MAG	Denmark	Europe

• Gene Location: Start: 108990; End: 111524 Strand: +

Full Sequence      

MKRIFYILLLLTVTVLSPSAAEQFVSFTKTSNGFPLLSPEEHSFTILCSGEDEHKGVLTA
IDNLQTDFEKVCGVKPEKANSTADNVKIIIGSIDSSPIIKQLIKAKKLDANLLKGKNEKY
IITTLHSPLKGIEGDVLLIAGSDKRGTIYGIYELSKQMGISPWYWWADVPVQHQDAIYIK
EGIYTDGEPKVKYRGIFINDEWPCMGRWSTEKFGGFNSKMYVHLYELLLRLKANFLWPAM
WSAAFYADDPMNSPLADEMGIIIGTSHHEPMARNHQEYARNRKAYGDWNYQTNKQGVDRF
FREGIERMKGKEEVVTIAMRGDGDAPMGSDTDTRLLESIVKEQRKIIANVTGKPASETPQ
LWALYSEVLEYYDKGMKIPDDVMILLCDDNWGDVRRLPDLNAKRHPGGYGMYYHVDLHGA
PRAYQWLNMTQIQHMWEQLILTYQYGVDKMWILNVGDLKPNEFPTDFFLRMAWNPTSYTA
DNLMDYTRDFCEQQFGEAQADEAARILNLYCKYTSRITAEMLDSKTYNLENGEFKAVTDE
FLALEAHAYRQFSSLLQEQKDAYRELILFPIQAMANLYELYYAVAMNRKLAQCGDVRANH
WADRAEYCFKRDAELCHDYNHHIANGKWNHMMDQTHIGYTSWDEPKGGNIMPEVKRVDIS
KSRTGGYEYEENNGVVVMEAERLAYCKQGKETKWTVIPDLGRTLSGLSLMPYNKSIEGAS
VSYKFKLKSDLKDVRLRLILDSTLPFVQGGHSYAISINGGKEQIINYNKDLNWTHNYSKM
YPAAAARIIESKVSFIDADLKAGDHILTIRPLVPAVVLHKIIIDCGSDGPSHLNLQESKF
NMKD

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	40	821	7.5e-270	0.9870875179340028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	187	521	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	5.68e-30	671	833	4	168	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	9.88e-08	57	154	33	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT78599.1	0.0	1	840	3	839
QUT26888.1	0.0	1	840	3	839
EDO10801.1	0.0	1	840	6	842
QRQ55179.1	0.0	1	840	6	842
SCV07743.1	0.0	1	840	6	842

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	0.0	1	839	12	850	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	5.60e-306	37	838	12	834	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	2.50e-304	37	838	11	833	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	9.59e-180	24	670	5	647	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	1.60e-135	36	649	11	652	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000226	0.999211	0.000147	0.000145	0.000135	0.000131

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001780_01906.