CAZyme Information: MGYG000001780_02787

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001780_02787
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	MGYG000001780_18|CGC1	37602.17	10.2098

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001780	6261722	MAG	Denmark	Europe

• Gene Location: Start: 94819; End: 95796 Strand: +

Full Sequence      

MVNPILFKIFVSSTYTAMNRINAIRLTAILALLVCAVAAQAQRRNARYVEYIEKYAPLAV
QQMKEHKIPASITLAQGLLESGAGQSALARKSNNHFGIKCGSNWRGRTVRHDDDARNECF
RAYSNPRDSYEDHSAFLKRGARYAFLFDLKITDYKGWARGLKKAGYATDPSYANRLITII
EDYDLYKYDSRGMSKRESRNWEKELKKKPWLANPHQVYIANDIAYVVARDGDTFRFLGKE
FDISWKKLVKYNDLHKDYTLEAGDIIYLKAKKKKASKPHTVYIVRDGDSMHSISQKYGIR
LKNLYKMNRKDAEYIPEVGDRLRLR

Enzyme Prediction     

No EC number prediction in MGYG000001780_02787.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	56	185	4.3e-37	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF038016	sporang_Gsm	1.86e-41	51	189	163	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
COG1705	FlgJ	3.47e-41	51	189	46	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	8.50e-30	50	189	10	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
TIGR02541	flagell_FlgJ	2.73e-28	48	180	151	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
pfam01832	Glucosaminidase	5.05e-27	56	185	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ62358.1	1.02e-199	18	325	1	308
QUT91907.1	1.02e-199	18	325	1	308
QDO71591.1	1.61e-193	54	325	34	305
QMI81840.1	5.28e-188	54	325	36	307
QPH57455.1	6.15e-187	54	325	36	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	1.07e-16	57	180	10	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.31e-16	57	180	11	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	9.00e-16	57	180	11	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN4_A	7.09e-12	68	205	23	163	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN5_A	1.36e-11	68	181	23	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	2.17e-16	64	189	65	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	1.05e-13	57	179	169	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P37710	7.26e-13	70	322	202	470	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q9KQ15	1.71e-10	54	198	167	323	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
P58231	2.04e-10	56	181	160	292	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.040502	0.948399	0.010239	0.000344	0.000245	0.000242

TMHMM  Annotations     

start	end
21	40