CAZyme Information: MGYG000001780_02944

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001780_02944
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
524	MGYG000001780_20|CGC3	59789.67	7.5203

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001780	6261722	MAG	Denmark	Europe

• Gene Location: Start: 98818; End: 100392 Strand: +

Full Sequence      

MKKIILAAILSGICSYAFAQPPTHFEIVTEQPLQVMEHFSASDAWSMHIIGKWPQEKQNL
VADWLFSTENDANGKPKGIGLSMWRFNVGAGSTEQGKASQIGSPWMRTECFLQPDGSYDW
NKQQGQRNFLRLAKERGVGKFLAFLNSPPVYYTQNGLATNTGRDGTLNLKEEHYEDFARF
LANMIKGVEKKDGIKFDYLSPFNEPDGHWNWIGPKQEGTPATKKEIARAVRLISKEFVKE
GIDTEIAICESSDYRCMFSTHMTNHERGYEIQSFFSPDSTDTYLGNTPKVLRLISGHSYW
TTTPLNMLRDYRRQLRDTLDKYKVDFWQTETCIMGNDEEIGGGHGFDRTMKTALYVARII
HHDIVYAGARSWQWWRAIGGDYKDGLIREYTVPDLHDGKVEDSKLMWILGNYSRFVRPGA
VRMSIRATNEKGQTIPEGDTDPKGLMCSAYRNVNGQWVMVVINYADREQNFTFHVNDSKV
KSWQGYRTSDKVGEDLLPIDKLKNKQLAVIPARSVVTFVSVVND

Enzyme Prediction     

EC	3.2.1.38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	24	519	8.4e-196	0.9958677685950413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	6.93e-149	34	387	13	366	O-Glycosyl hydrolase family 30.
COG5520	XynC	1.02e-16	109	519	89	427	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68226.1	0.0	1	520	1	520
ALJ59968.1	0.0	1	520	1	520
QUT89019.1	0.0	1	520	1	520
ALJ60213.1	0.0	1	520	1	520
QUT88786.1	0.0	1	520	1	520

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	1.83e-94	25	519	8	495	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6IUJ_A	3.25e-15	2	520	4	471	ChainA, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	1.64e-14	34	520	104	542	Crystalstructure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]
1NOF_A	1.55e-12	74	489	18	349	ChainA, xylanase [Dickeya chrysanthemi],2Y24_A Chain A, XYLANASE [Dickeya chrysanthemi]
6M5Z_A	6.24e-11	34	519	34	452	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q76FP5	7.52e-14	1	260	1	266	Endo-beta-1,6-galactanase OS=Hypocrea rufa OX=5547 GN=6GAL PE=1 SV=1
G2Q1N4	2.06e-10	1	463	1	410	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1
Q6YK37	6.66e-08	155	519	121	420	Glucuronoxylanase XynC OS=Bacillus subtilis OX=1423 GN=xynC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001237	0.973698	0.024215	0.000285	0.000262	0.000245

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001780_02944.