CAZyme Information: MGYG000001781_00149

Basic Information

• Species: Acutalibacter sp000432995
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter; Acutalibacter sp000432995
• CAZyme ID: MGYG000001781_00149
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
619	MGYG000001781_2|CGC1	71161.37	5.63

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001781	2596092	MAG	Denmark	Europe

• Gene Location: Start: 61374; End: 63233 Strand: +

Full Sequence      

MLKNIWGPDMTLKEEELLRRERRNRKYMMDLKSENLLLNFELEAGRFTTPYLPEGIHGGW
EAQACQLRGHFLGHWLSAAAMRYHATGDAEIKAKADAIVHELALCQEENGGQWAGSIPEK
YLHWIARGKQVWAPQYNLHKTFMGLVDMYELAGNQEALEVADRFADWFYQWSGTFTQEQF
DDILDFETGGMLEIWVQLLNHTGKDKYRELMDRYYRRRLFNPLLEGKDVLTNMHANTTIP
EVLGCARAYEVTGEQRWRDIVEAYWKLAVDQRGQYATGGQTSGEIWSAKGFLGARLGDKN
QEYCTVYNMLRLADYLFRWTKDSRYADYIEMGIYNGLMAQAYWQRFKTNGQHYDTPDEGL
LTYFLPLAPGSKKGWASETNDFFCCHGTLVQGNSSWERGILYQEGEELYLAQYFNFVAKV
EVKGQPVHLSMTRDTLTGSFHLSSTSSARQNIHENTAKYPHHPDCRAEVITVETETPVEF
TLNLRAPWWIQGEAVVTINGGEEVRVKPSGFVSLRRVWQSGDVVRMEMPMGITTWSLPED
SDTVAFLYGPVTLAGLCGEERQLTVKGDAASVLVHDGEREWGAWRDTFKTVGQERGIRFI
PLYQVGYEAYSVYFPLKRC

Enzyme Prediction     

No EC number prediction in MGYG000001781_00149.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	11	554	1.8e-165	0.9940357852882704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	9.18e-114	24	554	16	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	8.66e-70	24	555	26	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE99157.1	7.72e-265	1	617	3	620
QIB58295.1	1.79e-263	7	617	9	620
QMW77732.1	1.79e-263	7	617	9	620
ANY76280.1	8.71e-260	2	616	1	617
AGA58936.1	9.36e-259	7	618	6	619

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	3.35e-60	9	560	32	566	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	3.88e-55	9	560	32	566	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	7.89e-13	134	532	186	534	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	4.17e-12	88	530	88	517	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QK0_A	9.58e-12	134	529	186	531	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001781_00149.