CAZyme Information: MGYG000001781_01813

Basic Information

• Species: Acutalibacter sp000432995
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter; Acutalibacter sp000432995
• CAZyme ID: MGYG000001781_01813
• CAZy Family: GH42
• CAZyme Description: Beta-galactosidase BgaA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
686		78432.8	5.1418

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001781	2596092	MAG	Denmark	Europe

• Gene Location: Start: 2674; End: 4734 Strand: +

Full Sequence      

MENKQRSHWDKLELGTCYYPEHWDKSLWEQDLRRMLDHGVTTIRIAEFAWSLTEPEEGVF
TFEFWDEFLDLAEQVGIKVIFCTPTATPPAWLTDKYPEVLNARRDGVLYRHGMRRHYNYN
SKKYQELSARVVEKLGEHYGKRPCIVGWQIDNEFNCETQEFYSESDTLAFREFLREKYGT
LDELNRAWGNAFWNQTYTAWEQIYVPRTTYGDGTNPHQKLDYMRFVSESAIRFCKMQSDI
LRKYVKPGDFITTNGLFGTLDNHRMTKDCLDVYTYDSYPNFAFAMREDPRHNNTLLDRKW
SRSLMEVRSVCPHFGIMEQQAGAGGSIGSDAPAPKPGQMMLWAMQSIAHGADYVSFFRWR
TATFGTEIYWHGLLDYDNLPNRKLAELQKLHARVEAIQELAGADYLAPVGLVKDYDNVFD
SNLDAWHGKLTRSSEMELFVGAQLAHAPMDAVYLQEGVTVEDLKQYRVLFCPHQVILTEA
QAQLLEAYVRQGGCLILAARTGQKDVDGHCVMKPMPGLLAPLTQTRVKEFTWIGPGDDPV
PMDWDGRTLDTGLFNDVLTATGEDAKVLARYGGDAWYAGEPALLETQAGKGRVLHFGGTL
TRENVTAFLEYLGVLEPYGDLIQAPSACEIALRRKGEQEYLIVLNYGKEPQEILLKRPVV
DLDDRCPVEGPVVLGSYETKVYRIGG

Enzyme Prediction     

No EC number prediction in MGYG000001781_01813.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH42	17	394	6.4e-128	0.9919137466307277

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	3.28e-144	17	397	1	376	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
COG1874	GanA	5.09e-104	14	681	18	669	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam08532	Glyco_hydro_42M	9.91e-31	407	612	1	200	Beta-galactosidase trimerisation domain. This is non catalytic domain B of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. This domain is related to glutamine amidotransferase enzymes, but the catalytic residues are replaced by non functional amino acids. This domain is involved in trimerisation.
cd03143	A4_beta-galactosidase_middle_domain	1.05e-09	409	530	1	120	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.
pfam08533	Glyco_hydro_42C	6.85e-05	629	683	3	57	Beta-galactosidase C-terminal domain. This domain is found at the C-terminus of beta-galactosidase enzymes that belong to the glycosyl hydrolase 42 family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIB55815.1	0.0	1	684	1	684
QMW76319.1	0.0	1	684	1	684
QBE95795.1	0.0	1	684	1	684
ANU77936.1	0.0	1	684	1	684
ASU30745.1	0.0	1	684	1	684

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LVW_A	2.00e-97	12	529	1	516	PolyextremophilicBeta-galactosidase from the Antarctic haloarchaeon Halorubrum lacusprofundi [Halorubrum lacusprofundi ATCC 49239]
1KWG_A	1.53e-89	14	536	2	520	Crystalstructure of Thermus thermophilus A4 beta-galactosidase [Thermus thermophilus],1KWK_A Crystal structure of Thermus thermophilus A4 beta-galactosidase in complex with galactose [Thermus thermophilus]
6Y2K_A	1.23e-88	12	527	1	526	ChainA, beta-galactosidase [Marinomonas sp. ef1]
3TTS_A	1.51e-70	11	649	8	638	ChainA, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_A Chain A, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus]
4UCF_A	2.44e-66	11	620	19	628	Crystalstructure of Bifidobacterium bifidum beta-galactosidase in complex with alpha-galactose [Bifidobacterium bifidum S17],4UCF_B Crystal structure of Bifidobacterium bifidum beta-galactosidase in complex with alpha-galactose [Bifidobacterium bifidum S17],4UCF_C Crystal structure of Bifidobacterium bifidum beta-galactosidase in complex with alpha-galactose [Bifidobacterium bifidum S17],4UZS_A Crystal structure of Bifidobacterium bifidum beta-galactosidase [Bifidobacterium bifidum S17],4UZS_B Crystal structure of Bifidobacterium bifidum beta-galactosidase [Bifidobacterium bifidum S17],4UZS_C Crystal structure of Bifidobacterium bifidum beta-galactosidase [Bifidobacterium bifidum S17]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B9LW38	1.09e-96	12	529	1	516	Beta-galactosidase Bga OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) OX=416348 GN=Hlac_2868 PE=1 SV=1
D9SM34	3.04e-96	12	649	1	622	Beta-galactosidase BgaA OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=bgaA PE=1 SV=1
Q9X6C6	1.81e-93	14	685	2	645	Beta-galactosidase BgaT OS=Thermus brockianus OX=56956 GN=bgaT PE=1 SV=1
D5JGG0	2.21e-92	10	651	6	629	Beta-galactosidase LacZ OS=Weizmannia coagulans OX=1398 GN=lacZ PE=3 SV=1
Q9RFN0	1.86e-90	11	684	6	666	Beta-galactosidase BgaB OS=Carnobacterium maltaromaticum OX=2751 GN=bgaB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001781_01813.