CAZyme Information: MGYG000001781_02225

Basic Information

• Species: Acutalibacter sp000432995
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter; Acutalibacter sp000432995
• CAZyme ID: MGYG000001781_02225
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
809		93277.54	4.8662

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001781	2596092	MAG	Denmark	Europe

• Gene Location: Start: 3374; End: 5803 Strand: +

Full Sequence      

MIVQKLTEQWTLTAPGQGEKVPAKVPGSVYADLLAAGKMKDPYYRDNELEALALMENDYL
YTETFTPEEGIMDCPHQVLRFEGVDTVADIRLNGVLLGHVENMHRTFEYDVAGILRPGEN
WLEVKFYSPTKWIREKYKENPAEGSSDAMKGFANLRKAHCMFGWDWGPHLPDAGLWRPVY
LLGVKGGKLESVLIRQHHSNGWVTLNLQPEFTYTDGGKLTYTAEVTDPDGNVSRYEDSPR
EILIEHPQLWWPHGYGDQPLYMVKVTAFLDGAEVDSWQRRIGLRTMTISREKDQYGESFA
HEVNGVKIFAMGADYIPEDNILSRITPERTRHLLEQCTAANFNCVRVWGGGYYPDDAFYD
ACDELGLMVWQDFMFACAVYNLTPDFAKNIREEVKDNVRRLRHHASLGLWCGNNEMEMFV
DQGEWVLNKRQKADYIRMYEYLIPEVLLTMDPDTFYWPASPSSGGGFDEPNDPTRGDVHY
WSVWHGQLPFAAYRQHQFRYLSEFGFESLPCMKTVETFTEPQDRNLFSYVMEKHQRCARG
SMLTMSYLQQMYLYPTSFETTLYASQLLQADAIRYGVEHFRRIRGVCMGAVYWQLNDCWP
VASWASIDYTGRWKALHYYAKRFFAPVLLSCCEEGMLSQEPNINAEPYDMEKSIRLSVSN
ETMQERACIVKWALRDSLGNIQREETISLTVPALTSVWLDKVELPDVDIFRDYVSYDLYE
GGKKISGGTVIFSVPKYFHYEDPQLACRVEGDEIVVTAKAYAKSVEIQNENEDLLLSDNY
FDMNAGETRVKILSGKPENLRLRSVYDIH

Enzyme Prediction     

No EC number prediction in MGYG000001781_02225.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	693	2.2e-104	0.6795212765957447

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.07e-94	3	630	12	635	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	2.92e-11	742	807	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10340	ebgA	5.43e-11	60	369	112	394	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17786	Mannosidase_ig	9.60e-09	654	737	3	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam00703	Glyco_hydro_2	2.29e-07	210	284	35	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE97789.1	0.0	1	808	15	836
QIB54534.1	0.0	1	808	1	822
QMW79049.1	0.0	1	808	1	822
QQQ93614.1	0.0	1	808	1	822
ASU28856.1	0.0	1	808	1	822

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	8.41e-150	13	808	25	847	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	8.64e-150	13	808	25	847	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	6.16e-149	13	808	23	845	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	6.33e-149	13	808	25	847	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	7.83e-146	3	809	8	841	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4WAH4	4.13e-121	25	803	32	839	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	1.59e-120	25	803	32	839	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
A1D911	1.20e-119	25	634	32	663	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
A2QYN2	4.49e-119	25	634	32	663	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
A1CGA8	3.46e-118	25	803	32	839	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000088	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001781_02225.