CAZyme Information: MGYG000001782_00570

Basic Information

• Species: Zag1 sp900555175
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag1; Zag1 sp900555175
• CAZyme ID: MGYG000001782_00570
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378		42964.17	9.0097

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001782	1923549	MAG	Denmark	Europe

• Gene Location: Start: 29488; End: 30624 Strand: +

Full Sequence      

MKKIFIITGEYSGDIHASHVVRALRAINSDIEIEGVGGENLKAEGVKLFSDQKKMGKVGL
SLGIISDHIVLGKKIVDYLTKEYKPDLVLLIDYGAFNLNISKFLKKAGIKVLYYIPPQVW
ASRKWRIHTIKKNIDEVLCIFPFEKEMYEKYGIKTHYCGHPLVSQLPKKADRDEFFEKHG
FDKNKKLISIFPGSREFELKYLMDVFIKTGLDLQKKHPDLQFCVSHAPNLSDNVYDKYLK
NSPFPVIRGENQALLSVSDALILASGTVALEACLYQTPMIIAYRGPWLFYLIYLMVIRIN
HVSLPNIIANKDIVPEILQGDVKVDKISHEIENLLYNQEYRAQNIKELGEVKSLLSDKNS
SKEAASVIAEFLGINKSL

Enzyme Prediction     

No EC number prediction in MGYG000001782_00570.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	354	2.6e-109	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.53e-123	1	373	1	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	8.38e-112	1	372	1	379	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.64e-84	4	364	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.69e-78	4	371	8	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	8.83e-48	1	370	1	346	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	1.63e-228	1	372	1	372
AEV32453.1	9.77e-78	3	373	2	368
AEH22144.1	1.13e-76	3	372	8	376
AWN74480.1	4.75e-76	2	372	5	379
ABG58662.1	4.46e-75	3	372	2	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.28e-50	4	337	9	347	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	3.19e-50	4	337	9	347	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q74AT9	1.61e-71	3	373	8	381	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q5WWX7	1.27e-70	3	360	6	367	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila (strain Lens) OX=297245 GN=lpxB1 PE=3 SV=1
Q5ZVR9	1.78e-70	3	360	6	367	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=lpxB1 PE=3 SV=1
Q1D393	6.85e-70	3	372	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
B6J161	3.14e-69	2	368	4	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001782_00570.