CAZyme Information: MGYG000001782_00905

Basic Information

• Species: Zag1 sp900555175
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag1; Zag1 sp900555175
• CAZyme ID: MGYG000001782_00905
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301		36509.53	9.2014

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001782	1923549	MAG	Denmark	Europe

• Gene Location: Start: 115140; End: 116045 Strand: -

Full Sequence      

MSNKIQKIIYYCWFGGNKPQNVLNCINNWREKLPEYEIVEINESNKELFNIEKECENNLW
LKTCYDNKMWAYVADYARLKVLYQQGGVYFDTDITIEKNITELLEKNKLVLGWEDNLSIN
IAVGIVVKQHPIIKQMLNFYDNEIWHTKLYTIPQIATYVLKKNYKLNSSNQITENKDILI
FPKEYFYPIPIGLKEKCNFITKNTYTIHWWDASWVKPNVDYFLKNKHRIPLEKLLKYCFE
KKVICNNLFLNIEQICQSYNIQINFYWLFRFKYKSDYKNNRWLVLFIFGIPFKVWKMYKG
N

Enzyme Prediction     

No EC number prediction in MGYG000001782_00905.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	21	106	3.4e-19	0.9666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	2.50e-20	4	265	81	328	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	3.27e-11	19	104	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam04572	Gb3_synth	1.43e-04	130	210	1	93	Alpha 1,4-glycosyltransferase conserved region. The glycosphingolipids (GSL) form part of eukaryotic cell membranes. They consist of a hydrophilic carbohydrate moiety linked to a hydrophobic ceramide tail embedded within the lipid bilayer of the membrane. Lactosylceramide, Gal1,4Glc1Cer (LacCer), is the common synthetic precursor to the majority of GSL found in vertebrates. Alpha 1.4-glycosyltransferases utilize UDP donors and transfer the sugar to a beta-linked acceptor. This region appears to be confined to higher eukaryotes. No function has been yet assigned to this region.
pfam05704	Caps_synth	0.002	2	107	43	147	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXU72845.1	4.86e-73	5	247	2	236
AXU36446.1	9.75e-73	5	247	2	236
AXU32658.1	9.75e-73	5	247	2	236
AXU28870.1	9.75e-73	5	247	2	236
AYC94671.1	1.38e-72	5	247	2	236

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9N289	1.64e-08	73	211	39	183	Lactosylceramide 4-alpha-galactosyltransferase (Fragment) OS=Pongo pygmaeus OX=9600 GN=A4GALT PE=3 SV=1
Q9JI93	1.69e-08	73	238	181	349	Lactosylceramide 4-alpha-galactosyltransferase OS=Rattus norvegicus OX=10116 GN=A4galt PE=1 SV=1
Q9N291	2.98e-08	73	211	174	318	Lactosylceramide 4-alpha-galactosyltransferase OS=Pan troglodytes OX=9598 GN=A4GALT PE=3 SV=1
Q9NPC4	3.99e-08	73	211	174	318	Lactosylceramide 4-alpha-galactosyltransferase OS=Homo sapiens OX=9606 GN=A4GALT PE=1 SV=1
Q67BJ4	1.75e-07	73	211	180	324	Lactosylceramide 4-alpha-galactosyltransferase OS=Mus musculus OX=10090 GN=A4galt PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001782_00905.