CAZyme Information: MGYG000001783_01141

Basic Information

• Species: Phocaeicola sp900551065
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900551065
• CAZyme ID: MGYG000001783_01141
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
296	MGYG000001783_17|CGC1	34448.53	10.0755

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001783	3080501	MAG	Denmark	Europe

• Gene Location: Start: 40218; End: 41108 Strand: +

Full Sequence      

MKSLRYILVFCLVGMVLSLGAAQRRNKAYEDYIRQYHKIAVEEMKRYHIPASITLAQGLL
ESGAGRSELARKSNNHFGIKCGRSWDGRTVRADDDAPNECFRAYRHAKDSYRDHSKFLRT
GARYASLFRLKITDYKGWARGLKKAGYATDPRYADRLINIIELYDLDRYDSKKGLEWAEE
FPNPHQPYLANDMVYIIARRGDTFKSLSDELGISKKKLRTYNELPKDYEFTGGEIVYLEK
KHRRATKEYIVYVVRQGDSMYSISQKFGIRLKNLYKLNKMEPDAPAPKVGDILRLR

Enzyme Prediction     

No EC number prediction in MGYG000001783_01141.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	38	166	1.1e-37	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF038016	sporang_Gsm	1.58e-41	40	170	171	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
COG1705	FlgJ	8.19e-40	45	174	59	192	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	9.38e-34	26	170	5	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	5.49e-28	38	166	2	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
TIGR02541	flagell_FlgJ	7.05e-28	18	161	129	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO23242.1	1.48e-168	7	296	10	297
ADY34780.1	1.87e-163	1	296	46	341
QEW37663.1	2.03e-152	4	296	1	297
QQY37845.1	2.10e-152	4	296	2	298
QQY41126.1	2.10e-152	4	296	2	298

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	5.06e-15	49	161	21	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	6.14e-15	49	161	22	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	4.23e-14	49	161	22	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5T1Q_A	2.96e-13	34	173	61	215	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3FI7_A	8.79e-12	30	170	31	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37710	1.79e-18	31	283	182	462	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
O32083	4.34e-18	45	170	64	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	6.95e-16	30	160	161	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q2G222	2.63e-12	34	173	321	475	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
Q9KQ15	3.49e-12	31	175	163	318	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001687	0.994316	0.003367	0.000198	0.000205	0.000204

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001783_01141.