CAZyme Information: MGYG000001783_01568

Basic Information

• Species: Phocaeicola sp900551065
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900551065
• CAZyme ID: MGYG000001783_01568
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
738	MGYG000001783_26|CGC1	84590.16	6.7726

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001783	3080501	MAG	Denmark	Europe

• Gene Location: Start: 27448; End: 29664 Strand: -

Full Sequence      

MKKWLCVIVCLFSLYTQAQVWTMKGKEPAGPGTWWCFRNTVTLDETPRSLELRLAADTKY
WLWVNGELQVSEGGLKRGPNPSDTYCDVITSLPALKAGKNTVAVLVWYFGKDGFSHCNSP
TAGISFSLSCNGKQVKPDKKWRVRLHPAYYVPEGEEPNFRLPESNIGFDAAKDIPFQSPD
YDDKKWEKATEISLEKAGWNRLVDRPIPFWKDYGLKPYARTEMQGDTLLRAYLPYNAQVT
PYLRLKASAGKCIRIRTDNYWGGSAPNVFAEYRTREGEQEFECKGWMNGHFVQYELPEGV
EVLDVKYRETGYDTSFAGSFACDDPMLTRLWNKAQRTLYITMRDTYMDCPDRERAQWWGD
VVNELGEAFYALDEKAHLLTRKGIHELMGWQRADSTIFAPVPAENYKDELPMQMLASVSH
YGFWTYYMGTGDRQTILDVLPRVKKYIHVWKTDSLGLVVPRSGGWTWGDWGENKDMTLLF
NLWYVIALKGYEEMNQLVGEPEEAAWAHATADRLRKVFHRTFWNGKYYISPGYQGKPDDR
AQALAVVSGVLPEALYPVIRPFFSEWYHASPYMEKYVLEALCTMGYYQDALNRMKLRYHA
MIESPLTTLWEGWGIGSEGFGGGTYNHAWSGGPLTILSQYIAGIETVEPAFRTFRVAPHP
AHLNFIRTQVPLSGGRRIVLEMDKSAHGGTMYLRVPEGTSAEVELPAEFRSWRVNGEPKS
ERQLRLSAGEWRFEMQAD

Enzyme Prediction     

No EC number prediction in MGYG000001783_01568.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	247	705	1.4e-83	0.9464285714285714
CBM67	21	193	1.4e-26	0.9431818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.03e-26	317	641	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam04685	DUF608	8.38e-06	312	528	17	216	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
pfam17390	Bac_rhamnosid_C	2.76e-05	643	708	1	66	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL36670.1	0.0	1	734	4	737
QDH54696.1	0.0	1	734	4	737
QUT48047.1	5.84e-258	21	706	27	715
AGY53286.1	3.15e-256	21	716	30	733
QLG44645.1	1.25e-249	21	716	28	728

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	8.70e-22	95	712	99	718	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	4.91e-09	263	640	115	541	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000260	0.999102	0.000178	0.000160	0.000149	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001783_01568.