CAZyme Information: MGYG000001784_01341

Basic Information

• Species: Mailhella sp003150275
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Mailhella; Mailhella sp003150275
• CAZyme ID: MGYG000001784_01341
• CAZy Family: GH103
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	MGYG000001784_36|CGC1	40345.03	5.5202

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001784	3348621	MAG	Denmark	Europe

• Gene Location: Start: 11781; End: 12881 Strand: +

Full Sequence      

MDCSMKGEDMTRGSWFRLFLILPLCLAAGSCSRAVDTGRPAEAALPPPAAEETAGGTVTL
ENVPEVWRPLVRQLEEDGIAGQEISWLFVRLGDELSQEPMGHKVRELYNVKYLPKPGSRE
QAPAVEGGDPIPKPWYKGVVTDANARRCRSFINMYAPAFHTAEETYGVPTEVAAALLFVE
TRLGDYLGDQNAFVTLASMAASRSPESIPDWMAALPDQAPEKLEWISRRMADKADWAYAE
LRHLLQYSLKNGVDPFEIPSSRYGAVGLCQFMPSSVARFAQDGNGDGIIDLFDPADAVAS
LSNYLALHGWKRDSTIPQKIKVLRRYNNLAIYANTILALSEKIREIPGRPAVNRPLPKPS
AVVSQR

Enzyme Prediction     

No EC number prediction in MGYG000001784_01341.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH103	134	321	3.3e-42	0.5423728813559322

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13406	SLT_2	4.87e-45	133	353	48	248	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
PRK10760	PRK10760	1.00e-28	119	316	96	269	murein hydrolase B; Provisional
COG2951	MltB	2.78e-27	123	337	73	269	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
cd13399	Slt35-like	4.56e-25	260	342	24	108	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	3.34e-05	246	306	3	75	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADP85790.1	1.73e-98	21	362	14	348
AAS95158.1	1.73e-98	21	362	14	348
ABM29301.1	6.96e-98	21	362	14	348
SFV73295.1	8.20e-90	28	343	55	362
QTO41794.1	1.17e-85	67	347	148	419

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1LTM_A	6.02e-20	137	316	78	230	AcceleratedX-ray Structure Elucidation Of A 36 Kda Muramidase/transglycosylase Using Warp [Escherichia coli]
1D0K_A	6.18e-20	137	316	80	232	ChainA, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0L_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0M_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1QDR_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QDT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUS_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli]
5O8X_A	6.06e-19	140	310	61	205	TheX-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa],5O8X_B The X-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
4ANR_A	7.52e-19	140	310	78	222	Crystalstructure of soluble lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5ANZ_A	1.06e-08	135	310	99	247	CrystalStructure of SltB3 from Pseudomonas aeruginosa. [Pseudomonas aeruginosa],5AO7_A Crystal Structure of SltB3 from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41052	5.29e-19	137	316	119	271	Membrane-bound lytic murein transglycosylase B OS=Escherichia coli (strain K12) OX=83333 GN=mltB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.014680	0.458243	0.522773	0.002210	0.001473	0.000586

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001784_01341.