CAZyme Information: MGYG000001784_02098

Basic Information

• Species: Mailhella sp003150275
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Mailhella; Mailhella sp003150275
• CAZyme ID: MGYG000001784_02098
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397	MGYG000001784_85|CGC1	43351.05	10.0965

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001784	3348621	MAG	Denmark	Europe

• Gene Location: Start: 11701; End: 12894 Strand: -

Full Sequence      

MRTLQIVNVRWYNATAWYGVTLARTLNAAGHRSRVVGLAETEPLRQARRMGMECEELPLN
DMAPHRLPALVRGMEDLLRRFRPDVVNCHRGESFVLWALLKRRFGFALVRTRGDQRLPRS
NVPNLWLHRKAADAVVSTNSRMSRHFLTRLGVPEERLFTVLGGVDTARFHASSVSRTTAR
ASFGFEPCDFVLGIVGRMDEVKGIRESIRALAAARKSWPAGGRLRLLVIGFDSQYSVNDV
NTWSEEAGLGPLDSPGAAVVVSGRVAQPEHAINALDMGVIASLGSETIARAALEIMACGV
PLVGSAVGVMPDILPQELLFAPGDVSEMSRLMLRAGNAAWLDAVRKTCHERIFCGAVPPV
PGIRPSGGLTLENFRDQTLAVYASALKRAGLTEGESL

Enzyme Prediction     

No EC number prediction in MGYG000001784_02098.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	4.24e-34	18	352	19	348	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03819	GT4_WavL-like	3.05e-28	18	345	16	330	Vibrio cholerae WavL and similar sequences. This family is most closely related to the GT4 family of glycosyltransferases. WavL in Vibrio cholerae has been shown to be involved in the biosynthesis of the lipopolysaccharide core.
cd03807	GT4_WbnK-like	3.90e-24	20	325	19	316	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.
COG0438	RfaB	1.86e-19	1	388	3	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
TIGR03088	stp2	2.14e-19	20	352	21	353	sugar transferase, PEP-CTERM/EpsH1 system associated. Members of this family include a match to the pfam00534 Glycosyl transferases group 1 domain. Nearly all are found in species that encode the PEP-CTERM/exosortase system predicted to act in protein sorting in a number of Gram-negative bacteria. In particular, these transferases are found proximal to a particular variant of exosortase, EpsH1, which appears to travel with a conserved group of genes summarized by Genome Property GenProp0652. The nature of the sugar transferase reaction catalyzed by members of this clade is unknown and may conceivably be variable with respect to substrate by species, but we hypothesize a conserved substrate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADP86584.1	5.42e-110	1	388	16	382
ABM28304.1	5.42e-110	1	388	16	382
ABB38453.1	4.73e-108	1	385	1	366
AAS96355.1	4.94e-105	9	388	1	359
EGJ48386.1	1.10e-103	1	391	1	371

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4FQ08	3.15e-10	55	311	86	354	D-inositol 3-phosphate glycosyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=mshA PE=3 SV=1
C6WPK3	2.99e-09	51	311	76	343	D-inositol 3-phosphate glycosyltransferase OS=Actinosynnema mirum (strain ATCC 29888 / DSM 43827 / JCM 3225 / NBRC 14064 / NCIMB 13271 / NRRL B-12336 / IMRU 3971 / 101) OX=446462 GN=mshA PE=3 SV=1
A8LZG1	7.35e-08	84	308	125	365	D-inositol 3-phosphate glycosyltransferase OS=Salinispora arenicola (strain CNS-205) OX=391037 GN=mshA PE=3 SV=1
D2S4K7	7.13e-07	84	308	117	351	D-inositol 3-phosphate glycosyltransferase OS=Geodermatophilus obscurus (strain ATCC 25078 / DSM 43160 / JCM 3152 / KCC A-0152 / KCTC 9177 / NBRC 13315 / NRRL B-3577 / G-20) OX=526225 GN=mshA PE=3 SV=1
C7Q4Y6	1.18e-06	84	387	109	412	D-inositol 3-phosphate glycosyltransferase 1 OS=Catenulispora acidiphila (strain DSM 44928 / JCM 14897 / NBRC 102108 / NRRL B-24433 / ID139908) OX=479433 GN=mshA1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001784_02098.