CAZyme Information: MGYG000001784_02240

Basic Information

• Species: Mailhella sp003150275
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Mailhella; Mailhella sp003150275
• CAZyme ID: MGYG000001784_02240
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354	MGYG000001784_98|CGC1	38884.1	8.1888

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001784	3348621	MAG	Denmark	Europe

• Gene Location: Start: 3769; End: 4833 Strand: -

Full Sequence      

MNHTSPYSQTPRNILVCQQRQIGDVLLTTPLLELLKRRWPQARVTLFTEAKCIPLLEGNP
HVDAFLALDKSRLHGLPAQLAWCRRAAARGFDLVVDCQQLPRCRMLTLFCALSGTETRLS
FPSAWTKLGLYNLAAAQKTDLYAAATKASLLAPLGIAWQGEKPRIYLADEERKEASALLG
SLGVSGNMRLITVDPTHRRASKRWPAERWARVLDLLAEDDASLRFLLLRGPGEDEDVQSL
KAMCAHADRILIPAPAPVLRLSAACMARAALHLGHCSAPRHMAVALDVPSIVVPGASGPE
WNYPSPEHVEFRPELSCSPCGRADCADPQCLLRVMPEEVAARARNMLDSLSTPS

Enzyme Prediction     

No EC number prediction in MGYG000001784_02240.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	84	328	4.8e-36	0.9466666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	1.11e-44	13	345	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	2.57e-25	11	339	1	322	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
PRK10422	PRK10422	1.05e-14	8	313	2	298	lipopolysaccharide core biosynthesis protein; Provisional
pfam01075	Glyco_transf_9	4.09e-10	195	325	112	241	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAS95478.1	3.39e-106	12	348	12	344
ADP86087.1	3.39e-106	12	348	12	344
ABM29007.1	2.74e-105	12	348	12	344
EGJ51210.1	2.64e-95	1	347	1	345
CCO23194.1	6.60e-94	11	342	9	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	4.79e-14	12	309	9	302	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25742	8.35e-13	20	313	2	286	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q9R9D5	3.00e-10	23	313	5	286	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001784_02240.