CAZyme Information: MGYG000001785_00392

Basic Information

• Species: UMGS1109 sp900548675
• Lineage: Bacteria; Firmicutes; Bacilli; ML615J-28; CAG-313; UMGS1109; UMGS1109 sp900548675
• CAZyme ID: MGYG000001785_00392
• CAZy Family: GH108
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
145		16896.51	9.6052

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001785	1621286	MAG	Denmark	Europe

• Gene Location: Start: 77762; End: 78199 Strand: -

Full Sequence      

MADYKKAIEKALKNEGGYVFDPDDAGGETFAGIARRYHKIWKGWEIIDNYKKEFNLPKNK
KQFNDKCFSDKKLMALVHSFYKDNFWDPFKLDLIPSFDISFLIFDTAINMGLVKAIKFAQ
QAVGLKETGKYDDELFNRLVKYGKK

Enzyme Prediction     

No EC number prediction in MGYG000001785_00392.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH108	8	111	4.6e-18	0.9767441860465116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05838	Glyco_hydro_108	1.27e-20	8	111	1	86	Glycosyl hydrolase 108. This family acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a C-terminal pfam09374 domain.
cd13926	N-acetylmuramidase_GH108	1.01e-14	2	111	1	91	N-acetylmuramidase domain of the glycosyl hydrolase 108 family. This domain acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a peptidoglycan binding domain.
COG3926	ZliS	1.23e-13	4	132	5	113	Lysozyme family protein [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWM90359.1	6.82e-104	1	145	1	145
QWM89060.1	3.99e-50	1	141	1	141
QOR58643.1	5.36e-48	1	141	1	141
QOR56442.1	3.71e-38	1	140	1	138
QOR56363.1	3.71e-38	1	140	1	138

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DNP_A	1.68e-08	4	129	6	112	ChainA, Secretion activator protein, hypothetical [Brucella abortus bv. 1 str. 9-941]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001785_00392.