CAZyme Information: MGYG000001785_00424

Basic Information

• Species: UMGS1109 sp900548675
• Lineage: Bacteria; Firmicutes; Bacilli; ML615J-28; CAG-313; UMGS1109; UMGS1109 sp900548675
• CAZyme ID: MGYG000001785_00424
• CAZy Family: GH3
• CAZyme Description: Glucosamine-6-phosphate deaminase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
772	MGYG000001785_5|CGC2	86510.72	6.222

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001785	1621286	MAG	Denmark	Europe

• Gene Location: Start: 39260; End: 41578 Strand: +

Full Sequence      

MNVKNMSLRDKVAQMMGFAFEGTNYNEQLKTQIEELKIGLLIFFKDNCENPKQVYELNKA
IYQNAAKVGMIPPFISLDQEGGMVARVTEGIVQSPGAMAISAAGDTSYAYKLAYNMGCDL
KKLGFNFNFAPVGDINNNPENPVINVRSYGEKPEVVCKYALEAVKGYTDAGLMTSVKHFP
GHGDTSVDSHIGLPKVDFDEKRIFEMELKPFIMAKEKNLPGIMAGHVMFTKYDKTYPTTL
SKNIVGGILREKLGYNGLVVTDSLTMSAVFDHFTLEEIAYRAIMAGNDILLLCGGRNIEM
QKAFYEASVKLVEDGKIPLEVIDAAVERILKAKEQFKVGSEKPALGIPFEQIKICNISDV
KYSEMVAEKSITLVKDNDNLLPISAKQKTLIVFPKIKVVTLAENEQSELTSLTDFMPYHC
DKIYMSLNPDDEEKLTLLSKMDEYERIIYCSYNAFFNEEQAKLINSLNPHKTIVIAFRTP
YDYNKLNVGTYLCAYEATPLSFKACAKVLTGAVKPTGTLPITLKERKRKNMKVYVVKDYD
AMSKKASEIFIEKIKANPYITLGLATGSSPIGTYKELIKAYNEHEISFENVKTYNLDEYC
GIDIKHPQSYYRFMHDQLFDHVNIKEENVHIPCASGENIAEQCKAYNDALNKTSIDLQLL
GIGTNGHIGFNEPGTSFEQETFVVTLAEGTRQDNKRFFNSIDEVPTHAMTMGIKNIMQAK
EILMLISGKGKAETVKRLLKGPITEDFPASILHKHPNVTVIIDEDAYSKMSE

Enzyme Prediction     

EC	3.2.1.-	3.2.1.52

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	70	291	7.2e-53	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01399	GlcN6P_deaminase	3.98e-127	540	769	1	231	GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P.
PRK00443	nagB	2.41e-108	531	772	1	249	glucosamine-6-phosphate deaminase; Provisional
TIGR00502	nagB	3.18e-91	531	770	1	247	glucosamine-6-phosphate isomerase. The set of proteins recognized by this model includes a closely related pair from Bacillus subtilis, one of which is uncharacterized but included as a member of the orthologous set. [Central intermediary metabolism, Amino sugars]
COG1472	BglX	3.63e-85	6	393	1	360	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	2.03e-83	7	332	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ART78538.1	1.56e-117	6	523	1	522
QOR67877.1	9.48e-117	3	523	2	516
VEU80306.1	3.77e-116	2	521	5	521
AQR77528.1	2.79e-113	4	523	5	526
ARF67361.1	2.79e-113	4	523	5	526

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	1.41e-105	2	523	7	531	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
2BKV_A	6.69e-73	531	768	1	239	Structureand kinetics of a monomeric glucosamine-6-phosphate deaminase: missing link of the NagB superfamily [Bacillus subtilis],2BKV_B Structure and kinetics of a monomeric glucosamine-6-phosphate deaminase: missing link of the NagB superfamily [Bacillus subtilis],2BKX_A Structure and kinetics of a monomeric glucosamine-6-phosphate deaminase: missing link of the NagB superfamily [Bacillus subtilis],2BKX_B Structure and kinetics of a monomeric glucosamine-6-phosphate deaminase: missing link of the NagB superfamily [Bacillus subtilis]
4ZM6_A	3.19e-70	1	523	1	527	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
3BMX_A	5.26e-69	3	523	39	617	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.57e-68	3	523	13	591	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0K934	1.37e-80	531	768	1	239	Glucosamine-6-phosphate deaminase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=nagB PE=3 SV=1
Q8R5T0	2.68e-80	531	772	1	243	Glucosamine-6-phosphate deaminase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) OX=273068 GN=nagB PE=3 SV=1
B0K0J7	2.81e-79	531	768	1	239	Glucosamine-6-phosphate deaminase OS=Thermoanaerobacter sp. (strain X514) OX=399726 GN=nagB PE=3 SV=1
B1HUU8	5.22e-76	531	761	1	232	Glucosamine-6-phosphate deaminase OS=Lysinibacillus sphaericus (strain C3-41) OX=444177 GN=nagB PE=3 SV=1
Q5WHY0	7.25e-76	531	768	1	239	Glucosamine-6-phosphate deaminase OS=Alkalihalobacillus clausii (strain KSM-K16) OX=66692 GN=nagB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001785_00424.