CAZyme Information: MGYG000001787_00383

Basic Information

• Species: Phocaeicola sp900551645
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900551645
• CAZyme ID: MGYG000001787_00383
• CAZy Family: GH65
• CAZyme Description: Kojibiose phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
674	MGYG000001787_6|CGC1	75130.16	5.8204

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001787	3320861	MAG	Denmark	Europe

• Gene Location: Start: 37241; End: 39265 Strand: +

Full Sequence      

MLRKIFITSFCAVLSSVSLAQSSVPGDGWHLATTDTIGYTGITLANGSIGLQTDKNPLSI
QSVVLNHVFDIADNQVSRIMQGINPFRLSLIVDGDTIRLQDMEQWSQTLDMKSATLTTSF
VLPKKAKIRCTTTALRNVAYSGLIHLSILPLQNIKISVHTEISVPAQEYQTPQEEYRTIW
GEGGRTDILRTQALSRGGKQRVCASSSFLYDTSCWKYQGNKEEASASLTARLVRGKETDV
ALVASTCSTRDFLGPVNESERRVVYMLHEGKEQLLNRHSQLWEELWQGDIEIEGDLKAQQ
QIRFALFNLYGSGSAGNRLSISPMGLSSQGYNGHIFWDAEMWMFPPLLLLQPTMARSMLD
YRFDRLAAAQKRALSFGYKGAMFPWESDDAGEEATPTFALTGPFEHHITADVGIACFQYF
QATQDTVWLAEQGYPLLREVAEFLASRVTRRSDGSYSICNVTGADEYANGVTDNAFTNGS
AILALRYAIQAAAICNRPCPEIWKDIADNLRILTFEDGTLQEYEGYQGTTIKQADANLLA
YPLELRTDPELIRQDLRYYENKIDQKNGPAMSYAIYAVQYARLQEPDKAYQMFLKSFVPH
ERPPFGVLAETPTSQNPYFMTGAGGLLQAVLYGFGGLTIDENGIRQLPSSLPSHWKSLTL
KGIGPERKTFVCTH

Enzyme Prediction     

No EC number prediction in MGYG000001787_00383.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	303	641	2.7e-99	0.9946236559139785

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1554	ATH1	4.51e-99	43	661	31	730	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
pfam03632	Glyco_hydro_65m	5.67e-66	303	644	1	387	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
PRK13807	PRK13807	1.86e-45	92	661	94	710	maltose phosphorylase; Provisional
pfam03636	Glyco_hydro_65N	2.00e-04	84	162	70	155	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37608.1	5.01e-250	39	671	38	671
QRQ48989.1	4.36e-247	13	671	12	668
QUT91743.1	7.09e-244	29	671	27	671
QIU93251.1	2.86e-242	2	671	1	666
QUT79346.1	1.57e-236	2	671	1	665

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE3_A	4.64e-181	27	674	22	678	ChainA, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]
3WIQ_A	1.16e-51	232	658	248	714	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
4KTP_A	8.53e-37	202	663	200	714	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	1.14e-36	202	663	200	714	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
1H54_A	1.44e-36	43	674	30	725	ChainA, Maltose Phosphorylase [Levilactobacillus brevis],1H54_B Chain B, Maltose Phosphorylase [Levilactobacillus brevis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q54KX5	1.35e-80	272	670	252	657	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Dictyostelium discoideum OX=44689 GN=pgghg PE=3 SV=2
Q8L163	4.42e-61	34	661	39	735	Kojibiose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=kojP PE=1 SV=1
A0JMP0	2.83e-57	278	663	186	585	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Danio rerio OX=7955 GN=pgghg PE=2 SV=1
F1NZI4	3.07e-57	251	663	209	637	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Gallus gallus OX=9031 GN=PGGHG PE=1 SV=3
Q32M88	5.61e-55	249	651	197	616	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Homo sapiens OX=9606 GN=PGGHG PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000290	0.998962	0.000214	0.000180	0.000176	0.000155

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001787_00383.