CAZyme Information: MGYG000001787_01723

Basic Information

• Species: Phocaeicola sp900551645
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900551645
• CAZyme ID: MGYG000001787_01723
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
274		31675.8	4.6812

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001787	3320861	MAG	Denmark	Europe

• Gene Location: Start: 18384; End: 19208 Strand: -

Full Sequence      

MSAKKVLFITQEITPYVPESELATIGQDLPQAIQDKGREIRTFMPKWGNVNERRNQLHEV
IRLSGMNLIIDDTDHPLIIKVASIQAARRQVYFIDNDDYFQHRLMAADENGNEYEDNGER
AIFYARGVLETVKKLRWCPDIIHCHGWMSAMVPLYIKKVYYDEPSFRDSKVVFSLYSDGF
KSNLADNFTSQLMLKDITPEDINMIKTPVNHEELYKLAVTYSDGVIQNSETINQNVLDYA
RKLNIPVLDYQPADTFADACDAFYDQVWDNADNK

Enzyme Prediction     

No EC number prediction in MGYG000001787_01723.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	5	237	6.5e-44	0.4682203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08323	Glyco_transf_5	1.84e-52	6	241	1	222	Starch synthase catalytic domain.
PRK14098	PRK14098	1.29e-49	5	214	7	223	starch synthase.
cd03791	GT5_Glycogen_synthase_DULL1-like	6.25e-35	5	175	1	164	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	4.67e-26	5	174	2	152	glycogen synthase GlgA.
COG0297	GlgA	1.00e-24	5	185	2	168	Glycogen synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO25341.1	1.38e-169	1	273	1	274
ADY34869.1	1.49e-168	1	269	1	270
AND20492.1	3.93e-155	1	268	1	269
QJR63829.1	3.93e-155	1	269	1	270
QJR68092.1	3.93e-155	1	269	1	270

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RZU_A	4.01e-08	6	194	3	181	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
6GNG_A	1.44e-06	6	202	42	245	GranuleBound Starch Synthase I from Cyanophora paradoxa bound to acarbose and ADP [Cyanophora paradoxa],6GNG_B Granule Bound Starch Synthase I from Cyanophora paradoxa bound to acarbose and ADP [Cyanophora paradoxa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4SC83	1.01e-43	5	228	7	238	Glycogen synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) OX=324925 GN=glgA PE=3 SV=1
B3EGV0	5.35e-43	5	242	7	253	Glycogen synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330) OX=290315 GN=glgA PE=3 SV=1
A1BIY8	1.45e-42	5	245	7	256	Glycogen synthase OS=Chlorobium phaeobacteroides (strain DSM 266) OX=290317 GN=glgA PE=3 SV=1
Q3B6C3	1.48e-41	5	228	7	238	Glycogen synthase OS=Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530) OX=319225 GN=glgA PE=3 SV=1
B4S584	7.95e-41	2	224	4	230	Glycogen synthase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) OX=290512 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999477	0.000446	0.000062	0.000003	0.000002	0.000028

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001787_01723.