CAZyme Information: MGYG000001787_02491

Basic Information

• Species: Phocaeicola sp900551645
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900551645
• CAZyme ID: MGYG000001787_02491
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
305		35553.43	9.7222

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001787	3320861	MAG	Denmark	Europe

• Gene Location: Start: 2072; End: 2989 Strand: -

Full Sequence      

MAKEPPILVVNKTDKPTSSSRRKRAASTSSASRKSRKSSGRKKRKGERHLPGWALWILGG
FSAIVFLSAFYYFFIRPYAYRWKPCSGLKAYGVCLPYGFEVHGFDISHHQGKIDWNELSK
AQYTPFPVRFVFMKASEGGDFSDTTFVHNFAEARKHGFIRGAYHFYNPKTDANRQADFFI
RSVDLEPGDLPPVLDIETRSDDMDKLRKDLLVWLRRIEAFYRVKPILYTSYKYKTRFLND
SIFNTYPYWIAHYYVDSVEYQGPWKFWQHTDVGTLPGIQEQVDLNVFNGSLEELQQMTIP
AKEEE

Enzyme Prediction     

No EC number prediction in MGYG000001787_02491.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	105	278	2.8e-50	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06524	GH25_YegX-like	4.54e-83	102	289	1	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd06413	GH25_muramidase_1	1.38e-62	99	289	1	191	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	8.77e-57	102	287	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	1.00e-51	105	278	2	180	Glycosyl hydrolases family 25.
COG3757	Acm	5.95e-45	101	295	63	261	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO25286.1	2.74e-157	1	300	1	289
ADY35571.1	2.53e-140	44	299	42	303
AII62469.1	7.26e-139	43	299	30	286
QJR56286.1	7.26e-139	43	299	30	286
QJR58916.1	7.26e-139	43	299	30	286

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAG_A	2.07e-28	99	295	14	214	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
1JFX_A	1.61e-21	101	290	5	205	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
6ZMV_A	1.02e-14	101	294	2	200	ChainA, muramidase [Trichobolus zukalii],6ZMV_B Chain B, muramidase [Trichobolus zukalii]
6ZM8_A	1.96e-11	101	294	2	201	ChainA, muramidase [Sodiomyces alcalophilus]
2X8R_A	3.75e-11	101	297	4	207	Thestructure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_B The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_C The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_D The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_E The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_F The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76421	1.59e-49	74	303	45	270	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8FFY2	3.15e-49	74	295	45	262	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
Q8X7H0	3.48e-48	74	303	45	270	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P25310	3.57e-20	101	290	82	282	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P26836	8.05e-16	101	287	9	196	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999955	0.000077	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
53	75