CAZyme Information: MGYG000001789_00062

Basic Information

• Species: Phocaeicola sp002161565
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp002161565
• CAZyme ID: MGYG000001789_00062
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
506		56305.28	5.8993

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001789	3544186	MAG	Denmark	Europe

• Gene Location: Start: 78630; End: 80150 Strand: +

Full Sequence      

MKTIQTLALGLCLALGACTTQPDSTVQTNDKGTQWEWKQGTIVVKTPERPAGQKSVLGLA
LPKMEVVRVGFVGLGMRGPGAVERFTYIPGTQIVALCDYEQERAEACQKLLQKASLPKAA
IYSGEKGYEELCKRDDIDLVYIAADWLHHFPIAKCALENGKNVAIEVPSAMNLKECWELI
DLSEKNRKHCMILENCCYDWFEMNTLNMAQQGVFGEIIRAQGAYIHNLNEFWDHYWKNGE
DDKLGWRLDYNMRHRGDVYATHGLGPVAQALNIHRGDRMETLVAMDTKSVVGKALVEART
DSACTNFRNGDHTTTLIRTANGKVIEIQHDVMTPQPYSRLYQLTGTKGFANKYPVEGYAL
DSEQLSASGVQPKVDDLSAHGFLPKAEQEALVAKYQHPILKKYGEMAKEVGGHGGMDFIM
DSRLVYCLQNGLPLDMDVYDLAEWCCLAELGELSMDNGCAPVAFPDFTRGEWNVIKGYKH
AYASPEEEAATLEKAKAFTAKLKSGN

Enzyme Prediction     

No EC number prediction in MGYG000001789_00062.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	63	473	9e-160	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	2.42e-22	64	364	1	271	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	8.09e-13	67	192	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	3.62e-04	65	185	3	113	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37128.1	0.0	1	503	1	503
QUT44459.1	0.0	1	503	1	502
QRQ49631.1	0.0	1	503	1	502
QUT62233.1	0.0	1	503	1	502
QQA30686.1	0.0	1	503	1	502

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	1.82e-84	49	472	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	1.66e-62	67	476	21	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E82_A	1.26e-08	66	217	12	148	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]
3E9M_A	4.52e-08	103	223	39	154	CrystalStructure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_B Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_C Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_D Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis]
3EVN_A	4.34e-06	67	218	6	149	CRYSTALSTRUCTURE OF putative oxidoreductase from Streptococcus agalactiae 2603V/r [Streptococcus agalactiae serogroup V]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6KWM1	0.0	1	503	1	503	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
A6L1Z2	0.0	1	503	1	504	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KYY1	5.45e-238	27	499	22	494	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
Q89ZX8	3.08e-210	38	483	28	466	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
A6KX96	4.11e-209	1	483	2	470	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000003	1.000046	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001789_00062.