CAZyme Information: MGYG000001789_00353

Basic Information

• Species: Phocaeicola sp002161565
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp002161565
• CAZyme ID: MGYG000001789_00353
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	MGYG000001789_3|CGC1	44028.32	9.3792

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001789	3544186	MAG	Denmark	Europe

• Gene Location: Start: 60929; End: 62080 Strand: +

Full Sequence      

MKYYLIVGEASGDLHASNLMRALLQEDPKAEFRFFGGDLMKEVGGTCVRHYKSLAYMGFI
PVLLHLRTILRNMEFCKNDVEAWNPDVLILVDYPGFNLKIAQYIKLHTEIPIFYYISPKI
WAWKEYRIKNIQHDVDAMFSILPFEVEFYQRYHFPVHYVGNPCVDAVDAFRKNFNETFET
FVSAHNWEQKPIIALLAGSRKQEIKDNLRRMIKASRYFPDYQFVVAGAPGIEADFYRRYM
DADTKIVFGETYRLLSHATAALVTSGTATLETALFRTPQVVCYYTAAGKLVSLLRRMILK
VPFVSLVNLIAGKEVVTELVAGDMQVKAIKQELSYILPGSERRKRMLENYDCLIQILGKA
GASGRAARQMLQALSAYKKRLYQ

Enzyme Prediction     

No EC number prediction in MGYG000001789_00353.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	356	4.4e-109	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.20e-95	1	374	2	375	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.81e-92	1	376	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	5.19e-74	4	344	2	346	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	8.46e-64	5	372	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.16e-41	1	363	2	338	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY36062.1	2.99e-239	1	382	1	382
QRO23865.1	4.76e-200	1	375	1	375
QQY38221.1	5.91e-180	1	374	1	377
ABR39591.1	5.91e-180	1	374	1	377
QUT59470.1	1.19e-179	1	374	1	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	5.21e-33	5	372	11	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	7.21e-33	5	372	11	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	2.79e-63	5	379	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q1D393	1.38e-55	6	374	10	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q1R020	1.30e-52	1	367	1	368	Lipid-A-disaccharide synthase OS=Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) OX=290398 GN=lpxB PE=3 SV=1
Q6ALW0	2.56e-52	6	367	15	379	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
B6J161	2.81e-52	5	368	8	368	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001789_00353.