CAZyme Information: MGYG000001789_00720

Basic Information

• Species: Phocaeicola sp002161565
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp002161565
• CAZyme ID: MGYG000001789_00720
• CAZy Family: GT11
• CAZyme Description: O-antigen biosynthesis glycosyltransferase WbnK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
146	MGYG000001789_7|CGC1	17509.91	6.6329

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001789	3544186	MAG	Denmark	Europe

• Gene Location: Start: 15939; End: 16379 Strand: -

Full Sequence      

MREQIDKDEHAVSLHVRRGDYLQPKHWEAIGCICQLSYYRNALEEMGKRVERPRYYVFSD
DLAWVKENLDLPDAVYIDWNKGEDSWQDMMLMSRCRHHIICNSTFSWWGAWLNPRNGKIV
IAPERWTRDADSREIVPAEWLRVSIK

Enzyme Prediction     

No EC number prediction in MGYG000001789_00720.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	3	142	1.9e-54	0.5

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	2.81e-51	6	125	133	253	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	1.28e-27	12	129	166	281	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.
cd11296	O-FucT_like	2.69e-04	12	108	75	196	GDP-fucose protein O-fucosyltransferase and related proteins. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT44870.1	1.87e-78	1	145	136	280
QRQ49131.1	1.52e-77	1	145	136	280
QQY37044.1	1.64e-74	1	145	136	280
QUT58051.1	1.64e-74	1	145	136	280
ABR40839.1	1.64e-74	1	145	136	280

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	2.41e-25	2	143	160	302	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
Q866C7	3.34e-16	6	112	210	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Ateles belzebuth OX=9507 GN=FUT1 PE=3 SV=1
Q866E8	3.34e-16	6	112	210	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Sapajus apella OX=9515 GN=FUT1 PE=3 SV=1
Q866F0	4.60e-16	12	112	216	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Saimiri boliviensis boliviensis OX=39432 GN=FUT1 PE=3 SV=1
Q866C9	4.60e-16	6	112	210	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Lagothrix lagotricha OX=9519 GN=FUT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001789_00720.