CAZyme Information: MGYG000001789_01470

Basic Information

• Species: Phocaeicola sp002161565
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp002161565
• CAZyme ID: MGYG000001789_01470
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485	MGYG000001789_19|CGC2	53382.19	5.9862

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001789	3544186	MAG	Denmark	Europe

• Gene Location: Start: 37502; End: 38959 Strand: -

Full Sequence      

MNLKRELGTAACLIALSLCALPVSASTDRVPAFPGADGAGKYTTGGRGGKVYTVNSLKDD
GSEGTLRWAIRKKGPRTIVFAVSGIIELQSPLYINNGDLTIAGQTAPGDGICLKNYTLGI
KADNVIIRFIRSRMGADIKQKGNDAMNGFNNHLDIIIDHCSMSWSTDECATFYDNRNFTM
QWCIASESLLNSIHEKGKHGYGGIWGGQPASFHHNLLAHHSNRTPRLCGSRYTGKPEEER
VELFNNVIYNYGSAGAYAGEGGSYNFLNNYYKPGPYTATVSSYKRLFTAYPDDGTNSNTK
GIHGVFYLNGNYMDDSCTKLSEKQRKDMQKVNKDNTVGLILKDKTADKTTYLSDSPFDIA
EHTSLQPAHEAYEAVLQYAGASFKRDAYDQRIVDETRQGIYHYEGSHGSTNGMIDQPSDV
GGWDEYQSDIAPIDTDSDGMPDEWEKQHGLNPNDASDGAVYSLSTDYTNLEVYLNGLVNH
LYPKN

Enzyme Prediction     

No EC number prediction in MGYG000001789_01470.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	83	271	2.3e-77	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3866	PelB	2.67e-06	13	306	9	314	Pectate lyase [Carbohydrate transport and metabolism].
pfam18884	TSP3_bac	4.23e-04	434	455	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.
smart00656	Amb_all	0.004	94	263	13	175	Amb_all domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37156.1	0.0	1	484	1	484
QGT73501.1	3.78e-269	28	484	41	497
QRQ55765.1	5.36e-269	28	484	41	497
SCV08373.1	5.36e-269	28	484	41	497
ALJ48955.1	5.36e-269	28	484	41	497

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B297	2.66e-49	18	482	8	415	Probable pectate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyC PE=3 SV=1
B8NQQ7	4.94e-49	27	482	17	418	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q2UB83	3.65e-47	27	482	17	418	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
Q4WL88	3.74e-44	24	482	15	419	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
B0XMA2	5.20e-44	24	482	15	419	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000560	0.846658	0.151878	0.000380	0.000284	0.000221

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001789_01470.