CAZyme Information: MGYG000001789_01673

Basic Information

• Species: Phocaeicola sp002161565
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp002161565
• CAZyme ID: MGYG000001789_01673
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
988		110605.25	7.6262

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001789	3544186	MAG	Denmark	Europe

• Gene Location: Start: 1863; End: 4829 Strand: -

Full Sequence      

MRKAVVLYICLLLSVWVEAHTMPSVLSQVKDTAACRRWVESRLSEMTLKQKIGQLFIHTV
DPVTAPRNKAQIRKAIEEYGLGGLLFAKGRIDQQVQLTNLAQQWSRIPLLITFDGEWGLA
MRLKDTPEFPKNRILGCVQDDSLIYRYGREVARQLREIGVQVNFAPVADVDNNPGNPVIN
TRSFGSNPKEVARKVIAYARGLEDGGVLAVCKHFPGHGDTDVDSHKALPVLPFDRARMDS
IELYPFRRAIDAGVSGMMVGHLQVPELEEKPASISSDIITTMLQDEFHFSGLVFTDALEM
RGIRQADDVCAQALLAGNDLLLAPRNLKREMTGVMNAIKKGLLTEEVITEKCRKVLTFKY
ALGLSQRPVVDEKDLKSRIRIPETDSLLLALDKAAVTVLKDSLEMLPLELALSGNVLLSI
SPSIVDSYPFYNGLQESITINWVHARVDSLQSIRKRLRTAQQVIVALHQKDYESYVPFLQ
ELAADKPLVVVSFVPQEDLKTMLPVLQHASAVVQAHVGTEAVQRYVAKVMTGRDKVTGRL
SVGIPGWCQAGVGITIDPDCPYLYTPEDFGMDSRILARIDTIAQEGIDAQAYPGCHVLIL
KDGYPVYNKCFGTFTYDGSRKVKENDLYDLASLSKVTGTLLAVMKLYDEGKFGLTDRVSQ
YLPMLEDTRKSRITVQDLLFHESGLPAYWAFYKEAIDSKSCKGGLFRKKYDRYHTLQVDE
NLYACTGFVYKKEWVSSVRTGKYVLPLSDSLYLNADFRKEINRQLADIPLKGHSYRYSCL
NFMLLKELVESVAGVALDVYLDSVFYKPMGLVHTAYNPLHRFDKSQIVPTAAEDFLRRTE
LQGYVNDEIAAFMGGVSGNAGLFSTAHDVGAVFQMLLDRGVYGGHRYLSRATCDLFITLQ
SEESRRGLGFDKPDTGHPEHSPCAAEAPQGVFGHTGFTGTCAWADPENDLVFVFLSNRTY
PRAFNHKNLTKLNIRTRMQQAMYQSIKR

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	101	322	2.7e-58	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	9.09e-77	46	423	1	363	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	2.19e-72	47	357	1	315	Glycosyl hydrolase family 3 N terminal domain.
PRK03642	PRK03642	1.02e-64	565	958	29	395	putative periplasmic esterase; Provisional
pfam00144	Beta-lactamase	5.34e-43	579	961	1	311	Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.
COG1680	AmpC	5.07e-40	570	972	32	377	CubicO group peptidase, beta-lactamase class C family [Defense mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37542.1	0.0	1	988	1	987
QRO23705.1	0.0	9	986	10	986
QEW35592.1	0.0	1	986	1	990
QQY39794.1	0.0	1	986	1	990
QQY43102.1	0.0	1	986	1	990

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	9.01e-60	46	371	11	343	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.26e-54	31	422	25	460	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3SQL_A	5.28e-54	78	355	55	342	CrystalStructure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQL_B Crystal Structure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQM_A Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_B Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_C Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_D Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002]
4GYJ_A	6.32e-54	31	422	29	464	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
3LK6_A	9.33e-54	33	422	1	434	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	6.92e-54	31	422	25	460	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
B4TD53	8.80e-45	565	967	29	404	Putative D-alanyl-D-alanine carboxypeptidase OS=Salmonella heidelberg (strain SL476) OX=454169 GN=yfeW PE=3 SV=1
Q8Z4S7	1.19e-44	565	967	29	404	Putative D-alanyl-D-alanine carboxypeptidase OS=Salmonella typhi OX=90370 GN=yfeW PE=3 SV=1
Q8ZN80	1.62e-44	565	967	29	404	Putative D-alanyl-D-alanine carboxypeptidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=yfeW PE=3 SV=1
Q5PCQ2	1.62e-44	565	967	29	404	Putative D-alanyl-D-alanine carboxypeptidase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) OX=295319 GN=yfeW PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000196	0.999199	0.000148	0.000156	0.000139	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001789_01673.