CAZyme Information: MGYG000001789_01685

Basic Information

• Species: Phocaeicola sp002161565
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp002161565
• CAZyme ID: MGYG000001789_01685
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
466	MGYG000001789_25|CGC1	52841.75	5.7567

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001789	3544186	MAG	Denmark	Europe

• Gene Location: Start: 22187; End: 23587 Strand: +

Full Sequence      

MNAFTRNTALLACLFLGGIASAQENGQPVNDSNTPLHLLKPAYRVGYGVVSADDIKQNMD
RVLRYLQGNTPTHVTDSRTGKRITDYARIDRHAQLERGAFRLASYEWGVTYSAMQAAYEA
TGDKAYQDYVYERFRFLAEVAPYFRKAYEKEGDIDPQMRQILMPKALDDAGAVCAAMLKA
QLKGAKLPVDDLIDNYFDFIINKEYRLDDGTFARNRPYHNSVWLDDMFMGIPAVALMGSY
DESKRQTYYDEAVKQIRQFADRMFVSEKGLFRHGWVEGMTDHPAFHWGRANGWAILTMCE
VLDVLPENYEGREDILNLLRAHVRGLAACQSKDGFWHQLLDRNDSYLETSATALYVYCMA
HAINKGWIDAMAYGPVVQLGWHAVSSAINEKGEVEGVCVGTGMGFDPAFYYYRPVNVYAA
HGYGPVIWAGAEMICLLKQQHPRSNDSAVLFYRTPQQTEEPIFNEE

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	100	433	2.3e-91	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	6.99e-98	81	437	3	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	4.39e-52	105	433	36	353	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37528.1	6.14e-287	6	466	3	463
VTZ55484.1	3.69e-265	1	463	1	463
QUT56860.1	8.97e-247	1	464	1	464
ALK86405.1	8.97e-247	1	464	1	464
QEW35585.1	8.97e-247	1	464	1	464

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	3.90e-224	29	463	6	440	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3QWT_A	2.23e-24	193	416	134	360	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
1NC5_A	2.34e-23	206	433	124	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	9.52e-23	206	433	114	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3PMM_A	4.04e-22	219	416	164	361	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.28e-22	206	433	124	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
O31521	2.71e-18	104	401	28	303	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P9WF04	9.30e-18	223	434	201	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
L7P9J4	5.53e-17	223	434	161	374	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000335	0.998775	0.000364	0.000181	0.000158	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001789_01685.