CAZyme Information: MGYG000001789_02176

Basic Information

• Species: Phocaeicola sp002161565
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp002161565
• CAZyme ID: MGYG000001789_02176
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000001789_42|CGC1	43601.85	7.1924

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001789	3544186	MAG	Denmark	Europe

• Gene Location: Start: 15899; End: 17023 Strand: -

Full Sequence      

MKIRRILLQLMITCLPLASYAQQEFRNWPKGTSPEEIGQLVSKRFVEVPHPNFDGNPTPP
NEITYPETCAWFGALRYADVTRNRELLKQLEERFLPIFGPERRLQPLPDHVDHTVFGIIP
LQLYMQTRNEVYYHLGMWYADAQWQMPRQNKHQAAYQALLDKNLSWQTRYWIDDMFMITA
IQSQAYYVTKNRTYIDRTAHEMVAYLDKIQRPNGLFYHAEDAPFYWGRGNGWMAAGMTEL
LGLLPEDNPDRPRILSSYRKMMKTLLDYQKEDGLWGQLVDDPTTWTETSGSAMFTYAMIK
GVKRGWLKAETYAPAVRKAWIALTGHIDEQGDIDGVCEGTNKTNDRQFYLNRRTLPGNMH
GQAPILWCVTAFLE

Enzyme Prediction     

No EC number prediction in MGYG000001789_02176.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	61	372	5.9e-75	0.9608433734939759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.88e-48	43	373	11	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	3.36e-46	58	366	29	347	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59941.1	9.86e-231	4	374	2	372
QUT89045.1	1.15e-229	4	374	2	372
QQT33758.1	1.83e-164	14	374	15	377
QQT56290.1	1.05e-163	14	374	15	377
QMV71337.1	1.49e-163	14	374	15	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	5.96e-33	162	367	191	405	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
5NOA_A	3.71e-22	156	324	146	325	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	6.49e-21	170	320	140	304	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
1NC5_A	5.52e-19	59	370	35	362	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	6.83e-19	214	370	175	352	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF04	2.25e-18	171	336	201	378	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	3.02e-18	59	370	35	362	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
L7P9J4	2.62e-17	161	336	154	343	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	8.77e-17	221	336	225	342	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
O31521	1.85e-15	171	340	133	303	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001372	0.988455	0.009404	0.000327	0.000223	0.000204

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001789_02176.