CAZyme Information: MGYG000001789_02223

Basic Information

• Species: Phocaeicola sp002161565
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp002161565
• CAZyme ID: MGYG000001789_02223
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
782	MGYG000001789_44|CGC1	86856.78	4.9049

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001789	3544186	MAG	Denmark	Europe

• Gene Location: Start: 17150; End: 19498 Strand: +

Full Sequence      

MKHLKNIALASVLCAGTCLSAEGQTVPPAIPSDPEIEANIQNWLKKMTIEEKIGQMCEIT
IDVVTDFEASQKDGFTLDKAKLDTVIGKYKVGSLLNVPLSIAQPKEKWAEAIRQIQELSM
KEIGIPCIYGVDQIHGTTYTLDGTLFPQGVNMGATFNRDLVKREAEISAYETKAGCIPWT
YAPVVDLGRDPRWSRMWENYGEDCYVNAEMGKASVIGFQGEDPNHIGKYNVAACMKHYMG
YGVPVSGKDRTPSSISRSDMREKHFAPYLAAVRQGALSVMVNSGVDNGMPFHANREYLTQ
WLKEDLNWDGLVVTDWADINNLCTRDHIAATKKEAIKIAINAGIDMSMVPYEVSFCDYLK
ELVEEGEVPMSRIDDAVARVLRLKYRLGLFDKPYWSTEDYPKFGSEEFAQVALQAAEESE
VLLKNEGGILPLAKGMKILLAGPNANSMRCLNGGWSYSWQGHRADECAQAYNTIYEALCN
KFGKENILYEPGVTYAPYKNDNWWEENTPEIDKSVAAAQNADVIIACIGENSYCETPGNL
TDLNLSMNQQNLVKALAATGKPVILILNEGRPRLIKDIEPLAKAVVNVMLPGNYGGDALA
NLLAGDANFSGKMPYTYPRHINALATYDYKPCENIGQMGGNYNYDSVMDIQWPFGFGLSY
TTYKYSNLKVDKAQFTADDALTFTVDVTNTGSVAGKESVLLYSKDLVASSTPDNIRLRNF
EKVSLNPGETKTVTMKLKGSDLAFVNYYGKWTLEKGDFKVKCGDQWIDLQCTQTKVWDTP
NR

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	121	349	1e-62	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	6.58e-155	1	763	1	751	beta-glucosidase BglX.
COG1472	BglX	3.20e-80	47	465	1	386	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.04e-71	48	383	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	3.36e-55	114	764	65	770	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.44e-52	421	660	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY35485.1	0.0	1	782	1	782
ADY36471.1	0.0	1	782	1	782
QRM99675.1	0.0	1	782	1	781
SCV07081.1	0.0	1	782	1	781
QRQ54588.1	0.0	1	782	1	781

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	0.0	24	782	1	759	Bacteroidesovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5XXL_A	8.05e-113	32	770	6	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	4.34e-112	32	770	6	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	5.41e-110	32	776	5	750	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	2.60e-102	37	763	4	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXU3	0.0	1	782	1	781	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
Q23892	3.73e-153	40	769	80	818	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
Q56078	2.54e-112	31	763	28	751	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.03e-110	1	763	1	751	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	8.00e-102	121	763	61	707	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001495	0.740364	0.257071	0.000433	0.000322	0.000280

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001789_02223.