CAZyme Information: MGYG000001789_02383

Basic Information

• Species: Phocaeicola sp002161565
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp002161565
• CAZyme ID: MGYG000001789_02383
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
271		31260.55	9.4292

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001789	3544186	MAG	Denmark	Europe

• Gene Location: Start: 11275; End: 12090 Strand: -

Full Sequence      

MRIIHYIPSIDRTSGGTTSYLQLLAKELGKLVELYVVTHASENPVEIENCQVYYIATLRH
VGEMKRQWMYWLNELEPDVVHVNTCWMPQCALVQRWAQRVGYKIVLTPHGMLEPWIMKRH
YWTRKVPALLFYQKAAIKKADCLHATAESEKENLLKLGYNSRITVIPNGIDVESIVLKQS
WKRNRQILFLSRIHVKKGIEFLLEAVAALKEKLQGYTIYIAGEGDAAYIDQLKTKVQSSG
IGQLVKFCGGVYGDEKWKLFRQADVFVLPTY

Enzyme Prediction     

No EC number prediction in MGYG000001789_02383.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03821	GT4_Bme6-like	1.38e-51	2	271	1	290	Brucella melitensis Bme6 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Bme6 in Brucella melitensis has been shown to be involved in the biosynthesis of a polysaccharide.
cd03801	GT4_PimA-like	3.64e-33	2	271	1	276	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	5.86e-31	1	271	1	285	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam13439	Glyco_transf_4	1.09e-21	15	173	2	169	Glycosyltransferase Family 4.
cd03811	GT4_GT28_WabH-like	7.04e-21	2	269	1	269	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT69715.1	2.33e-146	1	271	1	271
QDH55398.1	4.69e-146	1	271	1	271
QUT82241.1	4.69e-146	1	271	1	271
QDM08332.1	4.69e-146	1	271	1	271
QUT23021.1	4.69e-146	1	271	1	271

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4JAK2	7.05e-14	15	270	16	261	Archaeal glycosylation protein 16 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) OX=330779 GN=agl16 PE=3 SV=1
Q59002	7.32e-09	162	270	173	291	Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1607 PE=3 SV=1
D4GU66	6.02e-06	72	269	82	275	Low-salt glycan biosynthesis hexosyltransferase Agl5 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl5 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001789_02383.