CAZyme Information: MGYG000001789_02504

Basic Information

• Species: Phocaeicola sp002161565
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp002161565
• CAZyme ID: MGYG000001789_02504
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
795		90542.36	5.6514

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001789	3544186	MAG	Denmark	Europe

• Gene Location: Start: 18198; End: 20585 Strand: +

Full Sequence      

MVMKKKAWALMVCLIGFSGLQAQDKLYPNTFALNEVTLLDGPFKHAQDLNGKVLMEYDVD
RLLAPFLKEAGLPPKGELFPNWAGLDGHVGGHYLSALAMHYAATGDEAFRQRMEYMIAEL
KRCQEKNGDGYIGGVPNGKALWSEIRKGNVALIWKYWVPWYNLHKLYAGLRDAWMYAGNE
EARQMFLDLCDWGIGVVSPLTDAQMEQMLDMEFGGMDEVYADAYQMTGDKKYLDTAKRFS
HHWLLDSMAKGVDNLDNKHANTQVPKAVGYQRIAELDHNRTYEDAASFFWHTVVENRSLA
FGGNSRREHFVAKTDSKSYIEDREGPESCNTNNMLKLTEGLFRMHPEASYVDYYERALYN
HILSTQHPEHGGYVYFTSARPAHYRVYSAPNQAMWCCVGTGMENHAKYGEFIYTHTHDSL
FVNLFIASELNWKEEGIRLRQETGFPAEEGSKLTVSVDKPRHFKMLVRHPWWVKASEMQV
LCNGKEYAVGSEPSSYVCIDREWKDGDVVEIRTPMHVKLEEFPNMPEYVAILRGPIVLGA
RVGTDHLDGLVADDSRWGHIASGPLVPVYETPFLIGERADIEEKLNHLRPVAGKPFHYTV
PGLFRSGKYKDLVLEPFYGIHDSRYMIYWLSMDETEYAHYQSEQKAEEEARIALDRRTVD
AIATGEQQPEADHLMKNENSTKGNFNGKAWRDAKDGGYFSYVLSTEGKSDMSLLITYWGN
ETADREFDILVDGKVIASENLVGKWNKQEFVDVEYALPDDALQGKKEITLTFQSKPGKIA
GGVFFIRLVTNEQGE

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	35	538	7e-206	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	3.93e-180	35	538	1	502	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.93e-112	33	546	9	508	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	1.14e-41	543	629	1	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37333.1	0.0	5	789	2	795
QCD36520.1	0.0	14	793	14	789
QUT88913.1	0.0	3	792	1	799
QDO68314.1	0.0	3	792	1	799
ALJ60078.1	0.0	5	792	2	799

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	3.52e-226	10	789	7	801	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	2.39e-218	10	789	7	801	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	2.21e-19	279	573	285	625	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	6.72e-19	224	537	203	543	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QK0_A	2.70e-18	279	573	285	625	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000622	0.996464	0.002280	0.000220	0.000215	0.000186

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001789_02504.