CAZyme Information: MGYG000001790_01682

Basic Information

• Species: Phascolarctobacterium_A sp900553055
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A; Phascolarctobacterium_A sp900553055
• CAZyme ID: MGYG000001790_01682
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
210		24779.54	9.5459

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001790	1816593	MAG	Denmark	Europe

• Gene Location: Start: 150; End: 782 Strand: -

Full Sequence      

MAAKRKTITRGSRRKKRSRLPECLIILVLLAGTCFAGWKIWNSDTVQMRFVYMWEHQQDI
ITYSQKNKVDPFLIAAIIKNESNFNHKAVSKVGAVGLMQIMPETGRWIAEQMGLDNYKDT
DLYQTRTNIRMGCWYLGELDHEFKHNLALVMTAYNAGRGQTHEWMQQYGWDDNFNDLKAI
PFPDTREYVQKVLQDRDKYYLLYRDKVPLQ

Enzyme Prediction     

No EC number prediction in MGYG000001790_01682.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	66	197	1.3e-28	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	2.16e-77	54	198	2	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	7.47e-55	56	204	6	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.31e-38	71	194	1	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	4.29e-32	57	208	140	292	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	7.33e-31	60	170	1	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV76946.1	3.17e-117	1	207	1	205
BBG64618.1	3.53e-92	13	207	4	198
QNP77119.1	1.14e-88	26	207	28	209
ADB46849.1	5.52e-67	14	204	3	193
AEQ23289.1	4.69e-63	14	203	7	193

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	3.90e-24	52	203	412	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	3.93e-24	52	203	416	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	3.97e-24	52	203	422	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	3.99e-24	52	203	426	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	4.03e-24	52	203	432	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	2.29e-17	39	200	467	625	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P44888	1.89e-16	76	206	448	578	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
P0AGC3	3.57e-16	63	208	487	633	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	3.57e-16	63	208	487	633	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
O31976	5.80e-16	52	198	1418	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.911795	0.058611	0.008860	0.000387	0.000213	0.020145

TMHMM  Annotations     

start	end
20	42