CAZyme Information: MGYG000001791_01488

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; UBA953; W0P29-029
• CAZyme ID: MGYG000001791_01488
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401		44797.87	9.6627

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001791	1747323	MAG	Denmark	Europe

• Gene Location: Start: 355; End: 1560 Strand: +

Full Sequence      

MQEAYWAAETTNLSECHLPLLDFIAGTAHASRAMTQKQFGKNRRGWTTRISQNPWGWGGW
TMWNVPVNAWFALHMWEHFLFTQDKEFLRKRAYPMMKEACLFWEDHLKELGENGAGFSTS
DAEADLAQLAGVPAGTLVPPGGWSHEWGPVEDGVAHDCQLVRGLFGNTAAAAEILGVDAA
WAKNLRRKRARIAPDKISKNGYLQEWMIDRPNMVRGHRHTSHLFAVFPGSEISPRRTPEL
AAAAKKSLDLRGNSGDSRRSWTWPWRAALRARLKEGEKAHEMLAGFAAHNLLPNLLATHP
PFQADGNFSYPAAVAEMLMQSHEDGIELLPAPCSAWKSGSVRGLKARGNVTVDFAWENGR
VTRCTLFSPQPREVRLTFNGKTETRATTLPPSVENARAKVR

Enzyme Prediction     

No EC number prediction in MGYG000001791_01488.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	2	383	4.8e-130	0.5041551246537396

CDD Domains     

MGYG000001791_01488 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SEH94499.1	3.74e-156	1	383	419	808
QWO98936.1	1.29e-153	8	390	23	411
QQR33257.1	6.45e-153	1	390	378	773
ANU60164.1	8.55e-153	1	390	388	783
ASB35806.1	8.55e-153	1	390	388	783

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RDY_A	9.04e-65	5	368	379	744	ChainA, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
4UFC_A	1.22e-60	5	368	379	733	Crystalstructure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
7KMQ_A	1.77e-60	5	382	400	763	ChainA, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
2EAB_A	2.46e-29	1	380	425	855	Crystalstructure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]
2EAD_A	1.47e-28	1	380	425	855	ChainA, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7W8	4.82e-60	1	380	436	816	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
Q5AU81	1.58e-32	1	357	412	776	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1
A2R797	4.23e-31	1	364	392	765	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
Q2USL3	4.49e-21	109	358	425	696	Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=afcA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999949	0.000083	0.000005	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001791_01488.