CAZyme Information: MGYG000001792_01236

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA11452
• CAZyme ID: MGYG000001792_01236
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397	MGYG000001792_131|CGC1	44780.64	9.4935

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001792	3531580	MAG	Denmark	Europe

• Gene Location: Start: 2754; End: 3947 Strand: -

Full Sequence      

MKEDRKTSPLIWIVAGESSGDLYGARLAADIRKIRPDAAIEGMGGVRMKEAGVEILVDST
ELGVIGLIEVLGSIFKFVRIMFYLLCEAKRRRPDAVVLIDYPGFNIRFAKRLKKAGIPVV
WYISPQVWVWRKSNIPKLARYCTKMMVIFPFEVDVYQGSGLDVEFVGHPLVEIVRERRDP
SLHRDPKRVLLLPGSRRSETKRLLFPMLETVAILKQRHPDLKFEIATPREKVRADVENDM
REFIMKHPDAVLPEIRVLCGKTAECLQTCTAGLAASGTVTVECAIAGLPLVVAYRLNPVT
FLLARLIIRRLFRNAFTMPNIILNRKVFEEFLQFQVVPEDLAEAMERILPGGERRAQADA
DMEEMVREIEGGVRGAGRNAALAVLQVADYARGRENV

Enzyme Prediction     

No EC number prediction in MGYG000001792_01236.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	11	368	1.3e-107	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.12e-124	8	389	1	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.81e-115	9	388	2	379	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	6.33e-92	11	384	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	4.88e-80	5	386	2	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.75e-48	56	347	42	315	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSH40861.1	1.09e-140	11	386	8	384
AVM45461.1	2.14e-127	11	389	14	393
QHI67954.1	1.63e-73	13	356	7	345
SNB45016.1	6.57e-72	13	356	2	341
QEM70104.1	1.38e-71	13	385	2	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.51e-51	11	388	9	381	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.51e-51	11	388	9	381	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3E4H8	1.47e-67	11	389	9	381	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
B8JE78	1.77e-65	11	357	11	351	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
Q2IL69	4.94e-65	11	357	11	351	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
Q2LVL8	6.95e-65	8	385	3	375	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B4UHR6	9.79e-65	11	357	11	351	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001792_01236.