CAZyme Information: MGYG000001792_01961

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA11452
• CAZyme ID: MGYG000001792_01961
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
504		57609.98	9.1131

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001792	3531580	MAG	Denmark	Europe

• Gene Location: Start: 687; End: 2201 Strand: -

Full Sequence      

MSLKRIVAGMSAAVLLGSISASETILFEENFHSPESSAGYRREAGTRYSPTGGRGNSGCL
FFESDSPKHSARMFLKLNPKQFAGKIRLSAWCRGENIGKSAPWFGPKVMLVCKTAHGAAY
PEIPKKRGTYSWEYGECEIETPPGCSELELVLGIQNCSGKLWIDDIKIEQLAPPVKFTYR
PYDIHLQKTPVLRGVMSGNHLEEKDFQDLKAWNVNFMRYQMNPGRKTDLSGREAFLKWIN
SEIRKIDSLIPRAERNGIRLLLDMHKGPGTEHTSVSSNRLNWNRYDVDTFVLAWEKLARR
YKNNPAVFGYDILNEPEMAKTARDVLGWQEIAERTVRAIRAIDPLKPIIIEPAEGGSPQG
FITLRPIQAEHLIYSVHFYHPQEYTHQTDQLKSPIRFQGGKAYIKKQLAPVLAFQKTYRV
PILVGEFSASAWAPDAHEYLKLCIEVFEEYGWDWIYHAFRESHWWDVELEGRMGHMIPAS
NTLRKQVLLEGFSANEHRKRVPVR

Enzyme Prediction     

No EC number prediction in MGYG000001792_01961.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	198	463	2.6e-43	0.7454545454545455

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	7.58e-20	206	457	30	271	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	6.97e-12	198	475	71	380	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45735.1	9.97e-108	8	495	4	508
AVM44368.1	4.80e-102	12	496	25	522
AVM43793.1	4.37e-99	21	496	18	507
AVM47005.1	1.70e-92	10	495	73	572
AVM44501.1	5.69e-80	68	495	69	503

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AMC_A	4.48e-15	193	459	14	288	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
3AZR_A	2.64e-14	193	459	14	288	DiverseSubstrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZR_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZS_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZS_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZT_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_C Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_D Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8]
3AMG_A	2.64e-14	193	459	14	288	Crystalstructures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8],3AMG_B Crystal structures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8]
3AOF_A	5.00e-13	193	429	14	256	Crystalstructures of Thermotoga maritima Cel5A in complex with Mannotriose substrate [Thermotoga maritima MSB8],3AOF_B Crystal structures of Thermotoga maritima Cel5A in complex with Mannotriose substrate [Thermotoga maritima MSB8]
5BYW_A	5.23e-12	211	433	102	332	ChainA, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_C Chain C, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_D Chain D, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_E Chain E, Endoglucanase H [Acetivibrio thermocellus ATCC 27405]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23548	7.96e-09	243	427	126	318	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
P54583	7.34e-07	213	464	119	360	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
W8QRE4	8.68e-07	244	379	111	248	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000936	0.998193	0.000284	0.000207	0.000188	0.000180

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001792_01961.