CAZyme Information: MGYG000001792_03137

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA11452
• CAZyme ID: MGYG000001792_03137
• CAZy Family: GH10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
443		51892.85	6.5019

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001792	3531580	MAG	Denmark	Europe

• Gene Location: Start: 101; End: 1432 Strand: -

Full Sequence      

MFSEEAKRLSREILAENSEIDFRIRTGTEMYRKGFGHFLLTDAAGKELPGATVRLKQKTH
EYKFGCNAFMIDSFPEKEQNERYEEVFASLFNLAVVPFYWSDLEPEPGKERFARDSSFCY
RRPAPDRVLEFCEKHGITPKGHPLCWHLFWPEWIPNNTVDNMRFLRNRIERIAARYKDRI
PIWDVVNEAQSRHPACRTDIPVFPDDYVERVFRMAERFLPDCRKLYNDDSTWWNWQGDYS
PSYRLIRRLQERGCSVDGIGVQYHMFENMLGDRCCGVNRPLTPRCILKCLDQYRKLDIPV
NFSEVSIISRRDLGDGDTFQELVAEKLYRLWFSHPATEAVIWWNLVDGTGAYAPLGSEKG
ENALRAGLVNYDFTPKAAFLALERLIRKEWHTECVLEYRAGGDNRFHGFYGQYEAEIETE
NGKVTLSVPLSKFSENEFRIAVK

Enzyme Prediction     

No EC number prediction in MGYG000001792_03137.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	59	381	1.7e-44	0.9570957095709571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00633	Glyco_10	9.27e-41	100	382	3	263	Glycosyl hydrolase family 10.
pfam00331	Glyco_hydro_10	4.31e-35	78	382	22	308	Glycosyl hydrolase family 10.
COG3693	XynA	1.88e-31	38	382	10	337	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44415.1	8.22e-206	3	441	4	439
QNL52536.1	5.79e-100	20	424	27	419
QHV94149.1	7.84e-100	20	440	31	443
AXE20297.1	1.01e-99	20	440	31	439
QIP12711.1	6.23e-99	20	440	31	443

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VBR_A	3.88e-27	53	389	4	323	Crystalstructure of complex xylanase 10B from Thermotoga maritima with xylobiose [Thermotoga maritima],1VBR_B Crystal structure of complex xylanase 10B from Thermotoga maritima with xylobiose [Thermotoga maritima],1VBU_A Crystal structure of native xylanase 10B from Thermotoga maritima [Thermotoga maritima],1VBU_B Crystal structure of native xylanase 10B from Thermotoga maritima [Thermotoga maritima]
3NIY_A	9.11e-27	53	389	20	339	Crystalstructure of native xylanase 10B from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3NIY_B Crystal structure of native xylanase 10B from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3NJ3_A Crystal structure of xylanase 10B from Thermotoga petrophila RKU-1 in complex with xylobiose [Thermotoga petrophila RKU-1],3NJ3_B Crystal structure of xylanase 10B from Thermotoga petrophila RKU-1 in complex with xylobiose [Thermotoga petrophila RKU-1]
7D88_A	2.98e-24	42	421	66	401	ChainA, Beta-xylanase [Bacillus sp. (in: Bacteria)]
7D89_A	1.14e-22	42	421	66	401	ChainA, Beta-xylanase [Bacillus sp. (in: Bacteria)]
6FHE_A	4.86e-22	103	382	60	338	Highlyactive enzymes by automated modular backbone assembly and sequence design [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O80596	9.28e-22	47	432	709	1052	Endo-1,4-beta-xylanase 2 OS=Arabidopsis thaliana OX=3702 GN=XYN2 PE=3 SV=1
Q12603	2.69e-20	38	329	22	287	Beta-1,4-xylanase OS=Dictyoglomus thermophilum OX=14 GN=xynA PE=3 SV=1
Q60041	4.60e-20	81	389	51	342	Endo-1,4-beta-xylanase B OS=Thermotoga neapolitana OX=2337 GN=xynB PE=3 SV=1
A3DH97	2.54e-18	40	434	400	750	Anti-sigma-I factor RsgI6 OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=rsgI6 PE=1 SV=1
Q2PGV8	3.78e-18	100	307	79	279	Endo-1,4-beta-xylanase 2 OS=Aureobasidium pullulans OX=5580 GN=xynII PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000013	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001792_03137.