CAZyme Information: MGYG000001792_03218

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA11452
• CAZyme ID: MGYG000001792_03218
• CAZy Family: GH10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347		39124.93	7.6449

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001792	3531580	MAG	Denmark	Europe

• Gene Location: Start: 29; End: 1072 Strand: +

Full Sequence      

MEFCRSKGIRLHGHTLVWGNNTWQIPDWLINRIPFDYLKKANLERNPANHTLPGNATAHA
FEGMSVREMEEALPEYAELINTLMAKRIIEIAMRYGDKVDSWDVVNESSLDFGQGLMVPG
SKLCKSAYGPMPGDYAYRGFKFAEGVLPPQVKLNINDYNLCDAYAEQVNDLRARGCRIDI
MGAQMHLFNPQTCLDIAEGRSLVQSPDKVRESMKCIGRAGLPIHLSEITITSPGSGRHGQ
IVQAGIARNLYRLWFSLEPMMGITWWNVVDGCGAPGEPAASGLFTREMEPKLSYFALEKL
ILHEWRTRLVRTADAESRVAFRGFRGRYRLAWTGADGREESMICHLK

Enzyme Prediction     

No EC number prediction in MGYG000001792_03218.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	1	297	1e-39	0.7755775577557755

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00633	Glyco_10	6.65e-40	1	297	22	263	Glycosyl hydrolase family 10.
pfam00331	Glyco_hydro_10	1.12e-34	1	297	65	308	Glycosyl hydrolase family 10.
COG3693	XynA	5.01e-25	2	297	89	337	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM47074.1	6.54e-205	1	347	150	496
AHF92621.1	6.79e-145	1	346	150	490
QQZ02681.1	5.25e-121	1	340	157	488
QGA28189.1	2.46e-118	1	347	160	504
AWI10666.1	1.67e-108	1	347	137	480

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EXP_A	1.35e-11	2	280	68	292	Beta-1,4-GlycanaseCex-Cd [Cellulomonas fimi],1FH7_A Crystal Structure Of The Xylanase Cex With Xylobiose- Derived Inhibitor Deoxynojirimycin [Cellulomonas fimi],1FH8_A Crystal Structure Of The Xylanase Cex With Xylobiose-derived Isofagomine Inhibitor [Cellulomonas fimi],1FH9_A Crystal Structure Of The Xylanase Cex With Xylobiose-derived Lactam Oxime Inhibitor [Cellulomonas fimi],1FHD_A Crystal Structure Of The Xylanase Cex With Xylobiose-derived Imidazole Inhibitor [Cellulomonas fimi],1J01_A Crystal Structure Of The Xylanase Cex With Xylobiose-Derived Inhibitor Isofagomine lactam [Cellulomonas fimi],2EXO_A Crystal Structure Of The Catalytic Domain Of The Beta-1,4- Glycanase Cex From Cellulomonas Fimi [Cellulomonas fimi],2XYL_A Cellulomonas Fimi XylanaseCELLULASE COMPLEXED WITH 2-Deoxy- 2-Fluoro-Xylobiose [Cellulomonas fimi]
3CUF_A	1.38e-11	2	280	68	292	Cellulomonasfimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with cellobiose-like isofagomine [Cellulomonas fimi],3CUG_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with cellotetraose-like isofagomine [Cellulomonas fimi],3CUH_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with cellotriose-like isofagomine [Cellulomonas fimi],3CUI_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with sulfur substituted beta-1,4 xylotetraose [Cellulomonas fimi],3CUJ_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with sulfur substituted beta-1,4 xylopentaose. [Cellulomonas fimi]
4W8L_A	1.32e-10	1	297	68	341	Structureof GH10 from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4W8L_B Structure of GH10 from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4W8L_C Structure of GH10 from Paenibacillus barcinonensis [Paenibacillus barcinonensis]
1NQ6_A	1.35e-10	1	270	67	272	CrystalStructure of the catalytic domain of xylanase A from Streptomyces halstedii JM8 [Streptomyces halstedii]
3RDK_A	3.03e-10	6	297	73	335	Proteincrystal structure of xylanase A1 of Paenibacillus sp. JDR-2 [Paenibacillus sp. JDR-2],3RDK_B Protein crystal structure of xylanase A1 of Paenibacillus sp. JDR-2 [Paenibacillus sp. JDR-2],3RO8_A Crystal structure of the catalytic domain of XynA1 from Paenibacillus sp. JDR-2 [Paenibacillus sp. JDR-2],3RO8_B Crystal structure of the catalytic domain of XynA1 from Paenibacillus sp. JDR-2 [Paenibacillus sp. JDR-2],3RO8_C Crystal structure of the catalytic domain of XynA1 from Paenibacillus sp. JDR-2 [Paenibacillus sp. JDR-2],3RO8_D Crystal structure of the catalytic domain of XynA1 from Paenibacillus sp. JDR-2 [Paenibacillus sp. JDR-2],3RO8_E Crystal structure of the catalytic domain of XynA1 from Paenibacillus sp. JDR-2 [Paenibacillus sp. JDR-2],3RO8_F Crystal structure of the catalytic domain of XynA1 from Paenibacillus sp. JDR-2 [Paenibacillus sp. JDR-2],3RO8_G Crystal structure of the catalytic domain of XynA1 from Paenibacillus sp. JDR-2 [Paenibacillus sp. JDR-2],3RO8_H Crystal structure of the catalytic domain of XynA1 from Paenibacillus sp. JDR-2 [Paenibacillus sp. JDR-2],4E4P_A Second native structure of Xylanase A1 from Paenibacillus sp. JDR-2 [Paenibacillus sp. JDR-2],4E4P_B Second native structure of Xylanase A1 from Paenibacillus sp. JDR-2 [Paenibacillus sp. JDR-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07986	1.36e-10	2	280	109	333	Exoglucanase/xylanase OS=Cellulomonas fimi OX=1708 GN=cex PE=1 SV=1
Q60037	1.45e-10	1	297	436	689	Endo-1,4-beta-xylanase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=xynA PE=1 SV=1
Q60042	4.56e-10	1	297	432	685	Endo-1,4-beta-xylanase A OS=Thermotoga neapolitana OX=2337 GN=xynA PE=1 SV=1
P23557	5.86e-10	1	234	31	223	Putative endo-1,4-beta-xylanase OS=Caldicellulosiruptor saccharolyticus OX=44001 PE=3 SV=1
A3DH97	1.30e-09	2	333	477	733	Anti-sigma-I factor RsgI6 OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=rsgI6 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001792_03218.