CAZyme Information: MGYG000001793_00429

Basic Information

• Species: CAG-632 sp002406015
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-632; CAG-632 sp002406015
• CAZyme ID: MGYG000001793_00429
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312		36247.64	4.4706

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001793	2608967	MAG	Denmark	Europe

• Gene Location: Start: 24176; End: 25114 Strand: +

Full Sequence      

MLPVNPNATKEARELLQYLYDTAGNHMITGQHTQTVPMEEREHIHNLTGKYPKLQGFELL
SYSPNINYNDTSEECLTEVVENRNTVSTALSWAKETNGIVSFCFHWFSPIGGKDKSFYTR
NTDFDPCQVLIEGTPERTAFFHDLDVIAVELQKFKDAQIPVLWRPLHESEGTWFWWGSKG
PEVASQLYRLLYHYYVDVKQLDNLLWVWSCQLKEGYPGDDYVDVVSWDIYLPAHTATDYK
EQYEELTANTSRKKVAALSEVGVIPDIKMLETSQVPWAYYMTWSKEFCLTEEYNYDSALQ
EMYNSPYAVTLE

Enzyme Prediction     

No EC number prediction in MGYG000001793_00429.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	4	311	5.5e-97	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.12e-56	4	310	1	308	Glycosyl hydrolase family 26.
COG4124	ManB2	1.12e-17	147	263	167	292	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK82137.1	4.25e-148	5	310	6	311
QNM01251.1	1.20e-145	1	311	6	334
AEB13973.1	5.88e-138	5	311	6	310
AZK45707.1	2.14e-126	3	312	6	315
AOZ93051.1	1.20e-121	3	312	9	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	1.22e-66	5	312	147	445	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	5.47e-60	3	310	6	306	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3WDQ_A	2.74e-46	3	300	34	335	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6D2X_A	3.08e-37	7	293	8	318	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]
6HF2_A	8.02e-37	8	283	50	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	9.04e-60	5	312	176	474	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	2.82e-53	8	287	151	433	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
Q5AWB7	3.99e-50	3	312	28	348	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
A2R6F5	9.32e-46	4	311	29	330	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55296	7.73e-43	4	304	158	450	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001793_00429.