CAZyme Information: MGYG000001793_00880

Basic Information

• Species: CAG-632 sp002406015
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-632; CAG-632 sp002406015
• CAZyme ID: MGYG000001793_00880
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
687	MGYG000001793_3|CGC3	77894.5	4.2589

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001793	2608967	MAG	Denmark	Europe

• Gene Location: Start: 238268; End: 240331 Strand: +

Full Sequence      

MTMTAVLIGGIIAGTAIHTYALDGEWKQNEKGWWYEYSDGTYLQNQWLQNDQNGNWYWLG
SDGYAAIGWTQINGKWYYFDENAVMWTGLQTITNTEGVTNTYYFTSSGEMLTGWQQVSSG
DWRYFNTSGAMSEDNSYAADSLKGIDVSKYQKDIDWTAVKNDGIQFAFIRVGHDEHVLDP
YFVKNIEAANAADMPVGVYFYSTSTTLEESISDAQWVIDQLQGHLISYPVVIDLEDKSQS
GSMTKGQITELGKAFCDEIRKAGYTPMIYCNENWAKNYINLDGAGDIERWIARYNGIYDT
SVKRDIWQGGSTARIQGIDGNVDVNFSFVDYTQVITPRTHADSSYVKTTGVWRQDGTGYW
YNYIDGSGYPKNQWLQIDGNWYWFNDSGYLSNPSGWQMLDNEWYYYDADGTAASGWREIN
GSWYYMLANGKMATGWVIVDNKWYYMGDAGDGVMKTGWLERNGSWYYLNDSGAAATGWAK
IKGSWYYFDPDSNAMVSGWRVVEGSWYYFGNAGDGSMKTGWQEVNGRWYYFGNSNDGTMA
TGWLRNGGRWYYMGASDDGSMKTGWDVVDGVWYYFGSAGDGSMKTGWQKINNHWYYLGGN
NDGAMKTGWQKINGSWYYMGEDGDGAMATGWQLIDGSWYYLGSAGDGAMKTGWQKINGNW
YYMYGSGVMASNAWVGGYYVDESGVWR

Enzyme Prediction     

No EC number prediction in MGYG000001793_00880.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	145	318	1.3e-44	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	5.04e-77	455	686	442	659	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	4.08e-70	370	579	441	640	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	2.13e-66	455	686	485	682	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
cd06414	GH25_LytC-like	4.71e-62	143	328	2	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
NF033838	PspC_subgroup_1	9.21e-44	349	528	506	682	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASM68843.1	2.81e-93	23	378	50	334
ACR76367.1	6.05e-63	26	357	70	366
ACU94532.1	2.29e-43	144	385	187	415
SET59461.1	3.68e-41	143	388	56	312
QCU01355.1	4.92e-41	116	385	56	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4KRU_A	3.36e-13	141	325	19	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	1.49e-12	141	325	19	205	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
2WAG_A	8.91e-11	142	325	16	204	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
4IWT_A	3.45e-08	352	390	6	43	Crystalstructure of the C-teminal choline-binding domain of the Streptococcus pneumoniae prophage LytA [Streptococcus pneumoniae GA60080],4IWT_B Crystal structure of the C-teminal choline-binding domain of the Streptococcus pneumoniae prophage LytA [Streptococcus pneumoniae GA60080]
1JFX_A	4.65e-08	142	325	5	200	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X7H0	1.95e-12	138	325	63	252	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P76421	2.62e-12	138	325	63	252	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8FFY2	3.53e-12	138	325	63	252	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
P26836	3.17e-11	139	325	6	194	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P34020	1.59e-08	142	344	1	201	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000733	0.998321	0.000204	0.000283	0.000225	0.000204

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001793_00880.