CAZyme Information: MGYG000001793_02072

Basic Information

• Species: CAG-632 sp002406015
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-632; CAG-632 sp002406015
• CAZyme ID: MGYG000001793_02072
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
764		84996.97	4.611

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001793	2608967	MAG	Denmark	Europe

• Gene Location: Start: 46247; End: 48541 Strand: +

Full Sequence      

MTREEAKKLVEQMTLEEKASLCSGKDFWRLKAVERLGIPEVMVCDGPNGLRKQKDGSDNV
NDSIEAVCFPGACAEAASFNRDAMQRAGEAMGNACQAENISILLGPGVNIKRSPICGRNF
EYYSEDPYLSGQIAAAHIKGIQSKNVGACIKHFAANNQETRRMTISAEVDERTLREIYLA
AFEEAIKEAKPWAVMCSYNQINGVFSSENHWLLTDVLKKEWEYDGLVVTDWGAVNDRVEG
LRAGLDLEMPGSGGTTDGKLVEAVKAGQLSEELLDDTCARIVSTIMTYAENKEEGATWNR
QEDHKIAVEIAKDCMVLLKNEDNILPLSKEKSAVFIGKFAEKPRFQGGGSSHVNTKNCST
VLEQVKTMEQVMYVSGFDTKDAVTAEEEQLEKQRFHDALAAAKQAEIAVIFAGLPDTYES
EAFDRKHMRLPEIQNQLIQAVSEIQPNTVVVLQNGSPVEMPWIHNVKAVLEAYLGGEGVG
EAIVATLFGESNPSGKLPETFPLKLSDNPSFLNFPGGTEKVEYKEGIFVGYRYYDKKEMP
VLFPFGHGLSYTTFSYTDMKVDKQEATDEETVTVSVTVQNIGDCFGKEVVQLYVQDVESR
VARPVKELKGFEKVGLEPGESKTVSFTLGKRAWAYYDVEAHGWYTEEGYFRLLTGSSSQD
IRLQQEVYIKPVQKVRHTYTMNTLLGDLYGNDDIKEEVAALKQMCDSLFDTQADNSLGES
TAAMMEAQTREMPLKSLPSFSDGKISRDYVEQMLKRLNQESVTE

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	250	2.6e-69	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	6.34e-101	69	665	120	761	beta-glucosidase BglX.
COG1472	BglX	3.69e-68	25	366	47	392	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	1.42e-66	315	531	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	7.78e-65	6	628	53	742	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	3.56e-40	35	283	63	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUI21624.1	3.28e-299	7	758	3	754
ALX08008.1	5.55e-297	7	758	6	752
ANV75754.1	5.55e-297	7	758	6	752
ADU74070.1	5.55e-297	7	758	6	752
ABN52488.1	5.55e-297	7	758	6	752

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.16e-297	7	758	6	752	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	8.86e-188	10	743	9	731	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	4.62e-136	1	670	1	843	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.40e-131	5	670	5	843	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
2X40_A	4.45e-129	4	664	2	708	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	1.11e-297	7	758	6	752	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	5.24e-182	10	739	9	735	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	2.09e-181	10	755	9	754	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
P27034	1.38e-142	9	675	5	815	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
A7LXS8	2.75e-139	12	662	52	738	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001793_02072.