CAZyme Information: MGYG000001795_00248

Basic Information

• Species: Amulumruptor caecigallinarius
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Amulumruptor; Amulumruptor caecigallinarius
• CAZyme ID: MGYG000001795_00248
• CAZy Family: GH32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
806		87256.56	4.5158

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001795	2604985	MAG	Denmark	Europe

• Gene Location: Start: 275142; End: 277562 Strand: +

Full Sequence      

MPLAIAGLVPTEGLNAARIAYIDMEADGSGRLTESVSGASLDIYGNFVPENIPGAVGKAL
RFDGYTTYVSGDLGQIGASDIEAMTVSLWIAPETYPIVEVDVATTKKIVVAGTIDNDAKK
GWAVSLGNNGNYSFDFYSDGMSGTVQADDKLPAYEWSHVVVVVGNNRVTIYRNGEKVSAI
RRCNKIDNAPTAFCIGKGAETSKTGVFNINTFNGLIDDIEVYDTALDLTEFAGVSPQNAA
DLSIPASRYEGDVLRPRFHGMPATAWTNECHGMTYSDGRYHLFFQKNANGPYMTRLHWGH
ISSENLYDWREEKIALVPGADYDIKGCWSGCVFTDDEITGGKPNIIYTGVDYVKASIAQA
EPVDDSLMEWNRKWDYPIISNAPAGLSDDFRDPYFFRNGDDAYIIVGTSKDGIGAATLHK
YSPKSGIWSNRGEIFFKGTSTNLDGRFWEMPTMTLMGDKWLFTATPLDTSRGVAALYWTG
NVNADGTFSPDNITPANIELPGFARDGYGLLSPTIFQHEGKTIALGIVPDKLPSEVNYDM
GYAHLYSLPREWSLDANGNLCQKPYAGLTAMRKGAGVVKKNVTLDGSEKLDGIGGREVEL
MGEFVIGSGKCGFTLLDDGASALRVYYDGTTNEVVVDASGLSRHVNDAGVFDGLYRSRLP
EQLSVGQTVKLHVYFDHSIVDFFINDTWAASVRVFAKGKMTEDVTAFSDTPVGASINAWN
LDAGNGASIDDVASDGAAYDLSAHAGMLEYGNLPVGAEVSVYDVSGRCMFRHKVDDSCGQ
LYTGLQGFHIVRVASADASESKTLAF

Enzyme Prediction     

No EC number prediction in MGYG000001795_00248.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	259	564	3.8e-52	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08996	GH32_FFase	1.08e-69	266	554	2	281	Glycosyl hydrolase family 32, beta-fructosidases. Glycosyl hydrolase family GH32 cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
smart00640	Glyco_32	1.40e-62	259	686	1	436	Glycosyl hydrolases family 32.
COG1621	SacC	8.73e-45	254	686	28	448	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	4.03e-44	259	564	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
cd18623	GH32_ScrB-like	2.65e-28	272	555	8	288	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB92629.1	7.95e-211	55	709	31	674
AEA21196.1	2.54e-209	55	709	31	674
QUB89002.1	2.54e-209	55	709	31	674
AXV49252.1	6.83e-205	50	709	336	984
QUB90817.1	4.41e-204	50	709	317	965

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	6.29e-29	256	686	27	448	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
6NUM_A	1.51e-21	256	686	41	475	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]
7BWB_A	2.20e-21	255	721	49	482	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
1ST8_A	4.08e-21	255	573	8	339	Crystalstructure of fructan 1-exohydrolase IIa from Cichorium intybus [Cichorium intybus],2ADD_A Crystal structure of fructan 1-exohydrolase IIa from Cichorium intybus in complex with sucrose [Cichorium intybus],2ADE_A Crystal structure of fructan 1-exohydrolase IIa from Cichorium intybus in complex with fructose [Cichorium intybus],2AEY_A Crystal structure of fructan 1-exohydrolase IIa from Cichorium intybus in complex with 2,5 dideoxy-2,5-immino-D-mannitol [Cichorium intybus]
7BWC_A	5.20e-21	255	721	49	482	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q67XZ3	5.87e-24	241	572	25	373	Beta-fructofuranosidase, insoluble isoenzyme CWINV3 OS=Arabidopsis thaliana OX=3702 GN=CWINV3 PE=1 SV=2
P43471	1.34e-23	255	710	33	475	Sucrose-6-phosphate hydrolase OS=Pediococcus pentosaceus OX=1255 GN=scrB PE=3 SV=2
P40714	1.93e-23	251	702	21	456	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1
P16553	1.45e-22	247	695	16	448	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
D2IGW7	5.60e-22	253	572	65	396	Fructan 1-exohydrolase OS=Bromus pictus OX=629273 GN=1-FEHa PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999670	0.000380	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001795_00248.