CAZyme Information: MGYG000001795_00722

Basic Information

• Species: Amulumruptor caecigallinarius
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Amulumruptor; Amulumruptor caecigallinarius
• CAZyme ID: MGYG000001795_00722
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324		36888.07	9.4278

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001795	2604985	MAG	Denmark	Europe

• Gene Location: Start: 7936; End: 8910 Strand: +

Full Sequence      

MKPMSIKTFVAAMAVTTMATATLFFPASASASSRNNDETRFANVVNPTLPRSVTFAGQKF
DLDNSDYYERLDRELTAMTFTHGTTLLTLKRANRYMPIIVLILKANGVPEDLVYLCAIES
NFNPLALSTAKAAGLWQFMPSTGREYGLEVNDYVDERYHPIKATEAATKYLKDAYARFGS
WESVAASYNAGMGRITRELAAQGTDSAFDLWLPQETMRYPFRLLAMKIILEHPKEFGYRL
RADQLYQPYDYYVVPVNSPVDSWADWAKEHGTTYLQLRTLNPWIRSSSLPNKSGKVYEVF
VPKKKSLTRSNRNKDVYNHDWVVK

Enzyme Prediction     

No EC number prediction in MGYG000001795_00722.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	105	225	3e-24	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	8.64e-65	103	228	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	4.40e-33	63	305	76	314	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	4.35e-29	104	204	6	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13401	Slt70-like	3.94e-19	95	222	6	133	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	6.66e-19	119	225	11	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD43280.1	8.90e-133	41	323	45	327
QCP73626.1	1.51e-131	41	323	45	327
QCD39978.1	1.51e-131	41	323	45	327
ASB38769.1	4.12e-127	34	323	30	320
QQR09511.1	4.12e-127	34	323	30	320

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	5.59e-26	63	304	73	310	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	5.59e-26	63	304	73	310	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000555	0.998471	0.000246	0.000289	0.000224	0.000190

TMHMM  Annotations     

start	end
9	31