CAZyme Information: MGYG000001795_01610

Basic Information

• Species: Amulumruptor caecigallinarius
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Amulumruptor; Amulumruptor caecigallinarius
• CAZyme ID: MGYG000001795_01610
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
612		68264.86	8.8891

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001795	2604985	MAG	Denmark	Europe

• Gene Location: Start: 57456; End: 59294 Strand: +

Full Sequence      

MQIYEFRDSFSVFCRKKLSLYIVAIRVERTAAHHNHPITPMNLYNQTDKSTRMTAFAIIL
VAVCVTFLPFLGCAPFFTKGEPREAVVALSMLQSGDWILPLSNGDVIPYKPPFLAWCIAV
ISLVTGGVTEYTSRLPSAIALIAMVMAGYRFWSRRVGIPAAMIGAVVTFTCFEVYRAGFA
CRVDMVLTAFIVTGMYSLYTWAMERDMSRLPWAAILLLSCGTLTKGPVAIILPLLAVWLT
VMLCGHNLWRCTWKMATVAFLALIIPALWYVAAWQRGGQAFLDLAMEENFGRMTGTMSYE
SHVNPWWYNLVTLIGGLAPYTLMLVIFAVCLLIPQLRHSVKNGLSRWRTADNARAFMFIA
PMVVLIFYCFPSSKRSVYLLPMYPFLAMQIGLLALWCARKASGVVKSYTGFICIVAMLTF
IVFCLFHIPALTSHHTAGLSADTLQAVSGFMEPASWWKWAVAGISCLVGGIVFVQLFRSG
TSTALVGLSAVMIALYMAFGGVYQPAAISYKTDIPMARDIEQIQPDGTIYSYIVSDMMRF
FTADFYIGDRIAPFSPTTSPVTGLILIGDDDVHEFHRLYDGKVRLEATVKRWDKKSCDIG
QPVTLYRYAIGR

Enzyme Prediction     

No EC number prediction in MGYG000001795_01610.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	51	555	2.9e-76	0.8833333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.38e-33	47	461	1	402	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	7.85e-10	81	495	33	422	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	2.53e-06	110	270	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	0.002	91	273	42	236	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAJ73913.1	2.34e-27	38	500	18	445
QDV85726.1	4.20e-27	52	391	37	364
BCX69460.1	2.41e-26	61	439	19	380
AWI08836.1	5.99e-26	31	418	86	464
QAY87139.1	1.92e-25	48	439	4	380

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2VBI7	4.14e-14	81	470	32	405	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=arnT PE=3 SV=1
O67601	7.72e-14	81	391	30	304	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
O67270	1.74e-11	53	388	2	315	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
Q2NRV9	3.39e-11	59	469	10	421	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=arnT2 PE=3 SV=1
B4TBG8	2.20e-09	81	416	33	358	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella heidelberg (strain SL476) OX=454169 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999371	0.000649	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
56	78
106	128
135	152
157	179
186	203
227	249
256	273
311	333
354	371
376	398
410	432
455	477
484	506