CAZyme Information: MGYG000001795_01748

Basic Information

• Species: Amulumruptor caecigallinarius
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Amulumruptor; Amulumruptor caecigallinarius
• CAZyme ID: MGYG000001795_01748
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
638	MGYG000001795_11|CGC1	71456.07	9.8458

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001795	2604985	MAG	Denmark	Europe

• Gene Location: Start: 55393; End: 57309 Strand: -

Full Sequence      

MMKNRISAFLITLATATCAVAAPSILDIKHSITDDNIIPPESFETQCRELEESFYLRNYA
TAASSDETPQKLGTPQEYEERLSKLPTEIEMPYNSIVGKYIDMYVGKRRAMVSDMLALHN
YYGNIFLEELEKQGMPTELQYLPVIESALKPNAVSRAGAAGLWQFMPATAKGLGMEVNSL
VDERRDPRSSSRNAATYLKQLYNIYTDWSLAIAAYNCGPGNVNKALRRAGGGKKDFWEIY
RFLPAETRGYVPAFIAANYAMNYYTEHNIQPRVVSRQLVTDTVTVNKRVHFNQIAQVLNI
PIDEIRMLNPQYRKDIIPGDNKPYTLVLPSQQVLSYVMSEPQILAYDEDIYRRRTYVEPN
TANDGSEGLEYIDPGAEQPDMAQSLNATYNLDLIQNFSERPIQKTHVVSRGENLRDIARQ
YGVSATDIKRWNNLRRGKVKEGDRLIIETYEADLTAIPSRSQLDTEALVASRTDVPAPRR
RSMETMPQVPAPAPKQETSATIVPSPKTAQESQAQADKTSPSVPQRRVYASTDRASETAS
ATSMPHAQSASATDSSIGSKQTTTTKRTIKKADDNKKKKATKKRTKKTSKPKRYTVKSGD
TLDRIAKRNGTTVKALQRANGIKGSMIRPGQKLTIPRK

Enzyme Prediction     

No EC number prediction in MGYG000001795_01748.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	127	259	2.4e-25	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	1.37e-64	130	259	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	2.57e-37	128	447	110	387	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	1.78e-32	125	235	1	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	3.63e-23	146	260	11	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	5.43e-21	146	261	31	148	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD38174.1	6.18e-213	16	638	16	572
QCP71857.1	6.18e-213	16	638	16	572
QCD42304.1	1.85e-207	2	638	1	584
QQR10036.1	6.31e-164	2	637	1	547
ANU62627.1	6.31e-164	2	637	1	547

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UZ2_A	1.61e-06	594	636	5	47	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]
2MKX_A	9.40e-06	594	635	7	48	Solutionstructure of LysM the peptidoglycan binding domain of autolysin AtlA from Enterococcus faecalis [Enterococcus faecalis V583]
6FBT_A	9.70e-06	146	274	474	603	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	9.92e-06	146	274	503	632	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	2.03e-29	91	447	71	384	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	2.03e-29	91	447	71	384	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
O31608	1.21e-10	146	250	85	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	3.99e-07	146	276	1447	1567	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	3.99e-07	146	276	1447	1567	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001579	0.585602	0.411988	0.000357	0.000244	0.000219

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001795_01748.