CAZyme Information: MGYG000001797_00114

Basic Information

• Species: CAG-590 sp900548855
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-590; CAG-590 sp900548855
• CAZyme ID: MGYG000001797_00114
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312		36240.72	4.6799

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001797	3663255	MAG	Denmark	Europe

• Gene Location: Start: 127272; End: 128210 Strand: -

Full Sequence      

MATPVNPRATKNAVQLLDYLYETAGNGIITGQHTQTVPMEEIEYIRKVTGKEPKLRGFEL
LACSPNINYEDTSEPCMQEVYENRGTLETAYQWAKETEGIVTFTFHWFSPIGGRDKSFYA
EHTDFDASRVLEEGSPERTAFFHDMDVIAESLKRFCEADIPILWRPFHESEGTWFWWGAK
GAEIARELYKLMFVHYTQVHHLDNLLWVWNCPLKEGYPGDEYVDVVSVDIYLEKYESTDY
REHYEKLVAATTGNKVAALAEVGYIPDIHKLEQSRVPWAYYMTWSKEFCIGEQYNRTEQL
KSMYASSYSVTL

Enzyme Prediction     

No EC number prediction in MGYG000001797_00114.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	5	312	1e-93	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	9.18e-49	5	311	1	308	Glycosyl hydrolase family 26.
COG4124	ManB2	1.87e-13	160	264	180	297	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM01251.1	4.07e-165	3	312	7	334
CBK82137.1	2.72e-158	1	311	1	311
AEB13973.1	1.70e-144	1	312	1	310
AZK45707.1	1.69e-130	3	312	5	314
QUL56288.1	1.25e-128	2	312	7	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	1.97e-63	3	311	5	306	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	4.21e-59	6	312	147	444	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	1.49e-45	2	312	32	349	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6Q75_A	2.11e-36	4	311	23	323	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
6HF2_A	8.63e-33	9	284	50	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5AWB7	1.24e-59	4	312	28	347	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
G2Q4H7	8.99e-55	6	312	176	473	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	4.39e-48	8	288	150	433	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	2.58e-45	5	312	29	330	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55298	9.68e-43	3	304	155	448	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001797_00114.