CAZyme Information: MGYG000001797_00654

Basic Information

• Species: CAG-590 sp900548855
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-590; CAG-590 sp900548855
• CAZyme ID: MGYG000001797_00654
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
470	MGYG000001797_3|CGC2	55607.99	6.2643

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001797	3663255	MAG	Denmark	Europe

• Gene Location: Start: 165401; End: 166813 Strand: -

Full Sequence      

MFQYDFSNHQNRHIRIEDMPEEYYKRIQKTTREDAFYPAWHIAPKCGLMNDPNGLCQING
VHHIFYQWFPAGPVHGLKHWYHLKTRDFIHYEDADVAMYPDQSFDFYGCYTGMAFREKER
TYIYYTGIQGKKHTPNTCYAEFDGENIVNRKKLFGADPLITTANCRDPYVWKKKNTYYML
VGGESPAHEGVLLMYEGSMPDRFTYIGNLDIGDYPFGYMLECPNYYEQENRGILFFSPMG
IKSHNKYDFKNVFSVVYAIGEPVNVENKSFRYETFYELDKGFDFYAPQSYEDEAHRRILF
GWLGNSKNEYPTDKNNWAHMMTMPRVLTIEGDRLVQTPLKELELLRGEEKPLCSWQSVED
CSFEIICEPEEKFEIEIGNISGHNICFSGDRWEYCLDRSRMTHLYALQYGNMRYGKRLEL
EQMIRIFADHSSLEIFCDGGKTVFTTRMFIENVSYIKVKGVKGNFYYLKR

Enzyme Prediction     

No EC number prediction in MGYG000001797_00654.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	41	338	3e-78	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01322	scrB_fam	4.22e-130	25	450	2	444	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd18623	GH32_ScrB-like	2.11e-119	47	331	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
COG1621	SacC	1.25e-109	12	469	4	481	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	7.45e-91	41	338	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	2.51e-89	41	440	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL26855.1	3.32e-239	1	470	1	474
QNM14265.1	1.62e-186	5	469	2	465
QGH49907.1	9.22e-172	5	468	2	469
AYO17801.1	9.22e-172	5	468	2	469
AQW61121.1	9.22e-172	5	468	2	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	3.83e-52	36	463	25	490	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
6NU7_A	1.01e-51	10	452	6	465	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7BWB_A	2.69e-48	22	457	34	468	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	3.71e-47	22	457	34	468	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
1UYP_A	1.98e-37	36	464	2	418	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13394	2.52e-125	10	462	10	466	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
Q05936	8.39e-82	10	466	7	481	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P07819	5.29e-70	24	449	13	453	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P13522	2.00e-64	12	469	8	478	Sucrose-6-phosphate hydrolase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=scrB PE=3 SV=3
P43471	1.97e-61	8	460	4	473	Sucrose-6-phosphate hydrolase OS=Pediococcus pentosaceus OX=1255 GN=scrB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000019	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001797_00654.