CAZyme Information: MGYG000001798_00253

Basic Information

• Species: Ruminococcus_D sp900752625
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_D; Ruminococcus_D sp900752625
• CAZyme ID: MGYG000001798_00253
• CAZy Family: GH5
• CAZyme Description: Endoglucanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393		44281.59	4.1385

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001798	2367577	MAG	Denmark	Europe

• Gene Location: Start: 6733; End: 7914 Strand: -

Full Sequence      

MKIIKLTAIISSCVLSLMGFCSCSSSDSDSISKSSTTMPEAEKVTIDKGTMHGYTAAELI
SQMKTGWNLGNSLDSLGGGETAWGNPETTQQLVDIIRDGGFDIIRIPVTWAEHMEGAPDY
TINPDFMDRVNEVVDYAIADDMYVILEIHHEPDSWLIPDSGHMAEVEPQFTALWQQIAER
FSDYGDKLIFESMNEPRVKGEPHEWTGGNEDERKCVNQLNRIFVDTVRASGGNNLERLLL
ITTHAQAVTESAIAGLELIEDEYVGVSLHAYIPYSFCYHSGESYETFAWDGSENGQVDYV
FDLIDKYITSSGFPVMITEYGAEFKVVDGKYNTGEIAKWITYFLGKANELNIPCVIWDNN
ERTLDRIPFGLFNRDEYKWYAEDILEAIMKVYE

Enzyme Prediction     

No EC number prediction in MGYG000001798_00253.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	80	360	9.8e-88	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	6.71e-57	80	360	16	269	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.60e-28	58	360	46	360	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOZ95201.1	1.83e-124	33	392	58	416
ADU86903.1	3.39e-122	40	390	63	412
ADL33047.1	8.40e-122	40	390	102	451
QPB75692.1	5.50e-114	49	390	66	407
ADU23111.1	5.50e-114	49	390	66	407

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4W85_A	7.10e-109	58	387	7	334	Crystalstructure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with glucose [uncultured bacterium],4W85_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with glucose [uncultured bacterium],4W87_A Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with a xyloglucan oligosaccharide [uncultured bacterium],4W87_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with a xyloglucan oligosaccharide [uncultured bacterium],4W89_A Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with cellotriose [uncultured bacterium],4W89_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with cellotriose [uncultured bacterium]
4W86_A	5.26e-106	58	387	7	334	Crystalstructure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with glucose and TRIS [uncultured bacterium],4W86_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with glucose and TRIS [uncultured bacterium]
4W84_A	5.44e-106	58	387	7	334	Crystalstructure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in the native form [uncultured bacterium],4W84_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in the native form [uncultured bacterium],4W88_A Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with a xyloglucan oligosaccharide and TRIS [uncultured bacterium],4W88_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with a xyloglucan oligosaccharide and TRIS [uncultured bacterium]
6WQP_A	2.60e-85	51	390	11	354	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]
6Q1I_A	1.61e-84	55	392	13	353	GH5-4broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum],6Q1I_B GH5-4 broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23660	3.67e-112	49	390	20	361	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
P54937	1.02e-82	55	392	38	378	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
Q12647	9.35e-79	46	390	15	361	Endoglucanase B OS=Neocallimastix patriciarum OX=4758 GN=CELB PE=2 SV=1
P23661	1.98e-77	32	390	49	398	Endoglucanase B OS=Ruminococcus albus OX=1264 GN=celB PE=3 SV=1
P28623	4.25e-77	56	390	43	370	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000008	0.006165	0.993837	0.000002	0.000003	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001798_00253.