CAZyme Information: MGYG000001802_00433

Basic Information

• Species: Megasphaera sp900548635
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Megasphaera; Megasphaera sp900548635
• CAZyme ID: MGYG000001802_00433
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
435		49754.38	9.4581

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001802	1944008	MAG	Denmark	Europe

• Gene Location: Start: 20; End: 1327 Strand: +

Full Sequence      

MLVSVPSAVMAMATAVYVYVQGREMFNKPIAFLAALFLVTSMGFMYIGKAAVTDMTLMFT
LTVTMISFYRKKYYTAYIFCGLSLLVKGPIGYAFPALIMLLYLAWTRQWSLMKEMKIPQG
ILLAFLVGLPWYILMYKVHGEVFLDTFIGYHNITRFAAPEHPGQNSLFFFIPILFAAMMP
WTAALFPTLRRLFQKRDPFKDTLQYCFVWAAFIFVFFSLSKTQLVTYIAPMFPPTAYLLG
WYWYRCYAERKFSQPLLVAMYILGFLVLACNAIPLHQDAAFFRPAIVWGTCLLAAALFLP
SVCLWRRSYRAAIVVGTAAMICFSWAAFGFILPKLQVHVTSYETAQMLPDVYDGHAPLYV
EKFLRPGIAYYSGMYGEEWDPVKDPDLETLLGRQDKIFLIMSKTTFHKLAKSQKLIDRFG
IAAETPTQVILINHP

Enzyme Prediction     

No EC number prediction in MGYG000001802_00433.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	346	1.3e-71	0.6722222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	6.85e-37	6	365	89	464	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	2.10e-26	14	333	95	429	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	7.13e-11	3	133	24	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	2.08e-08	26	139	109	240	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1287	Stt3	0.003	8	231	119	332	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVO73979.1	1.79e-273	6	435	90	519
CCC72524.1	1.79e-273	6	435	90	519
AVO26796.1	2.54e-273	6	435	90	519
ALG41392.1	3.60e-273	6	435	90	519
AXL21031.1	5.80e-194	6	435	90	519

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.06e-19	81	240	200	361	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4ETL9	5.64e-17	7	257	91	348	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1
A6V1N8	4.21e-16	80	240	172	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=arnT PE=3 SV=1
A4WAM1	5.65e-16	27	240	108	329	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Enterobacter sp. (strain 638) OX=399742 GN=arnT PE=3 SV=1
Q02R27	7.48e-16	3	352	83	434	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=arnT PE=3 SV=1
O67270	8.83e-16	8	236	86	314	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
31	53
73	104
117	136
167	189
202	219
224	243
256	275
285	304
311	333